Recombinant Human TMEM119 protein, GST-tagged
| Cat.No. : | TMEM119-3714H |
| Product Overview : | Recombinant Human TMEM119 protein(119-218 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 119-218 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TMEM119 transmembrane protein 119 [ Homo sapiens (human) ] |
| Official Symbol | TMEM119 |
| Synonyms | OBIF |
| Gene ID | 338773 |
| mRNA Refseq | NM_181724.3 |
| Protein Refseq | NP_859075.2 |
| MIM | 618989 |
| UniProt ID | Q4V9L6 |
| ◆ Recombinant Proteins | ||
| TMEM119-12H | Active Recombinant Human TMEM119 Protein, Fc tagged | +Inquiry |
| TMEM119-3714H | Recombinant Human TMEM119 protein, GST-tagged | +Inquiry |
| Tmem119-6826M | Recombinant Mouse Tmem119 Protein (Full Length), C-Fc tagged | +Inquiry |
| TMEM119-16899M | Recombinant Mouse TMEM119 Protein | +Inquiry |
| TMEM119-367H | Recombinant Human TMEM119 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM119 Products
Required fields are marked with *
My Review for All TMEM119 Products
Required fields are marked with *
