Recombinant Human TMEM14B Protein (1-114 aa), GST-tagged
| Cat.No. : | TMEM14B-836H |
| Product Overview : | Recombinant Human TMEM14B Protein (1-114 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-114 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 39.1 kDa |
| AA Sequence : | MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | TMEM14B transmembrane protein 14B [ Homo sapiens ] |
| Official Symbol | TMEM14B |
| Synonyms | TMEM14B; transmembrane protein 14B; MGC1223; FLJ60468; |
| Gene ID | 81853 |
| mRNA Refseq | NM_001127711 |
| Protein Refseq | NP_001121183 |
| UniProt ID | Q9NUH8 |
| ◆ Recombinant Proteins | ||
| TMEM14B-4589R | Recombinant Rhesus Macaque TMEM14B Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMEM14B-283H | Recombinant Human TMEM14B Protein, MYC/DDK-tagged | +Inquiry |
| TMEM14B-740H | Recombinant Human TMEM14B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TMEM14B-4775R | Recombinant Rhesus monkey TMEM14B Protein, His-tagged | +Inquiry |
| RFL14824HF | Recombinant Full Length Human Transmembrane Protein 14B(Tmem14B) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM14B-998HCL | Recombinant Human TMEM14B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM14B Products
Required fields are marked with *
My Review for All TMEM14B Products
Required fields are marked with *



