Recombinant Full Length Human Transmembrane Protein 14B(Tmem14B) Protein, His-Tagged
Cat.No. : | RFL14824HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 14B(TMEM14B) Protein (Q9NUH8) (1-114aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-114) |
Form : | Lyophilized powder |
AA Sequence : | MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDP RNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM14B |
Synonyms | FLJ60468; MGC1223; OTTHUMP00000214289; OTTHUMP00000214290; OTTHUMP00000214297; OTTHUMP00000214298; OTTHUMP00000214299; RP3-417M14.1; TM14B_HUMAN; TMEM14B; Transmembrane protein 14B |
UniProt ID | Q9NUH8 |
◆ Recombinant Proteins | ||
RFL14824HF | Recombinant Full Length Human Transmembrane Protein 14B(Tmem14B) Protein, His-Tagged | +Inquiry |
TMEM14B-740H | Recombinant Human TMEM14B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMEM14B-283H | Recombinant Human TMEM14B Protein, MYC/DDK-tagged | +Inquiry |
TMEM14B-4775R | Recombinant Rhesus monkey TMEM14B Protein, His-tagged | +Inquiry |
TMEM14B-836H | Recombinant Human TMEM14B Protein (1-114 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM14B-998HCL | Recombinant Human TMEM14B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM14B Products
Required fields are marked with *
My Review for All TMEM14B Products
Required fields are marked with *