Recombinant Human TMEM14B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM14B-740H
Product Overview : TMEM14B MS Standard C13 and N15-labeled recombinant protein (NP_112231) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions.
Molecular Mass : 12.2 kDa
AA Sequence : MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAWLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM14B transmembrane protein 14B [ Homo sapiens (human) ]
Official Symbol TMEM14B
Synonyms TMEM14B; transmembrane protein 14B; MGC1223; FLJ60468;
Gene ID 81853
mRNA Refseq NM_030969
Protein Refseq NP_112231
UniProt ID Q9NUH8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM14B Products

Required fields are marked with *

My Review for All TMEM14B Products

Required fields are marked with *

0
cart-icon