Recombinant Human TMEM159 Protein, GST-tagged
| Cat.No. : | TMEM159-4769H |
| Product Overview : | Human LOC57146 full-length ORF ( NP_065155.2, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | TMEM159 (Transmembrane Protein 159) is a Protein Coding gene. |
| Molecular Mass : | 43.9 kDa |
| AA Sequence : | MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSADFEGLYQE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TMEM159 transmembrane protein 159 [ Homo sapiens ] |
| Official Symbol | TMEM159 |
| Synonyms | PROMETHIN; TMEM159; transmembrane protein 159 |
| Gene ID | 57146 |
| mRNA Refseq | NM_020422 |
| Protein Refseq | NP_065155 |
| MIM | 611304 |
| UniProt ID | Q96B96 |
| ◆ Recombinant Proteins | ||
| TMEM159-301371H | Recombinant Human TMEM159 protein, GST-tagged | +Inquiry |
| RFL993MF | Recombinant Full Length Mouse Promethin(Tmem159) Protein, His-Tagged | +Inquiry |
| RFL35229RF | Recombinant Full Length Rat Promethin(Tmem159) Protein, His-Tagged | +Inquiry |
| TMEM159-4769H | Recombinant Human TMEM159 Protein, GST-tagged | +Inquiry |
| RFL5908HF | Recombinant Full Length Human Promethin(Tmem159) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM159 Products
Required fields are marked with *
My Review for All TMEM159 Products
Required fields are marked with *
