Recombinant Human TMEM237 protein, His-tagged
Cat.No. : | TMEM237-8544H |
Product Overview : | Recombinant Human TMEM237 protein(1-264 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-264 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MGKNPVRPPRAIPPVPSQDDIPLSRPKKKKPRTKNTPASASLEGLAQTAGRRPSEGNEPSTKELKEHPEAPVQRRQKKTRLPLELETSSTQKKSSSSSLLRNENGIDAEQAEEAVIQKPRRKTKKTQPAELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTIDVALTVHRAFRMIGLFSHGFLAGCAVWNIVVIYVLAGDQLSNLSNILQQYKTLAYPF |
Gene Name | TMEM237 transmembrane protein 237 [ Homo sapiens ] |
Official Symbol | TMEM237 |
Synonyms | TMEM237; transmembrane protein 237; ALS2CR4, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 4; JBTS14; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 4; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein; ALS2CR4; FLJ33282; DKFZp313L091; |
Gene ID | 65062 |
mRNA Refseq | NM_001044385 |
Protein Refseq | NP_001037850 |
MIM | 614423 |
UniProt ID | Q96Q45 |
◆ Recombinant Proteins | ||
TMEM237-17014M | Recombinant Mouse TMEM237 Protein | +Inquiry |
TMEM237-9375M | Recombinant Mouse TMEM237 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17699HF | Recombinant Full Length Human Transmembrane Protein 237(Tmem237) Protein, His-Tagged | +Inquiry |
RFL-32039XF | Recombinant Full Length Xenopus Laevis Transmembrane Protein 237(Tmem237) Protein, His-Tagged | +Inquiry |
TMEM237-8544H | Recombinant Human TMEM237 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM237-8891HCL | Recombinant Human ALS2CR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM237 Products
Required fields are marked with *
My Review for All TMEM237 Products
Required fields are marked with *
0
Inquiry Basket