Recombinant Human TMEM237 protein, His-tagged
| Cat.No. : | TMEM237-8544H |
| Product Overview : | Recombinant Human TMEM237 protein(1-264 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-264 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MGKNPVRPPRAIPPVPSQDDIPLSRPKKKKPRTKNTPASASLEGLAQTAGRRPSEGNEPSTKELKEHPEAPVQRRQKKTRLPLELETSSTQKKSSSSSLLRNENGIDAEQAEEAVIQKPRRKTKKTQPAELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTIDVALTVHRAFRMIGLFSHGFLAGCAVWNIVVIYVLAGDQLSNLSNILQQYKTLAYPF |
| Gene Name | TMEM237 transmembrane protein 237 [ Homo sapiens ] |
| Official Symbol | TMEM237 |
| Synonyms | TMEM237; transmembrane protein 237; ALS2CR4, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 4; JBTS14; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 4; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein; ALS2CR4; FLJ33282; DKFZp313L091; |
| Gene ID | 65062 |
| mRNA Refseq | NM_001044385 |
| Protein Refseq | NP_001037850 |
| MIM | 614423 |
| UniProt ID | Q96Q45 |
| ◆ Recombinant Proteins | ||
| TMEM237-8544H | Recombinant Human TMEM237 protein, His-tagged | +Inquiry |
| RFL-5576BF | Recombinant Full Length Bovine Transmembrane Protein 237(Tmem237) Protein, His-Tagged | +Inquiry |
| RFL36273MF | Recombinant Full Length Mouse Transmembrane Protein 237(Tmem237) Protein, His-Tagged | +Inquiry |
| RFL-2260GF | Recombinant Full Length Chicken Transmembrane Protein 237(Tmem237) Protein, His-Tagged | +Inquiry |
| TMEM237-17014M | Recombinant Mouse TMEM237 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM237-8891HCL | Recombinant Human ALS2CR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM237 Products
Required fields are marked with *
My Review for All TMEM237 Products
Required fields are marked with *
