Recombinant Human TMEM27 protein, His-tagged
| Cat.No. : | TMEM27-3506H |
| Product Overview : | Recombinant Human TMEM27 protein(163-222 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 163-222 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LSGIWQRRRKNKEPSEVDDAEDKCENMITIENGIPSDPLDMKGGHINDAFMTEDERLTPL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TMEM27 transmembrane protein 27 [ Homo sapiens ] |
| Official Symbol | TMEM27 |
| Synonyms | TMEM27; transmembrane protein 27; collectrin; NX17; 0610008J07Rik; kidney-specific membrane protein; NX-17; |
| Gene ID | 57393 |
| mRNA Refseq | NM_020665 |
| Protein Refseq | NP_065716 |
| MIM | 300631 |
| UniProt ID | Q9HBJ8 |
| ◆ Recombinant Proteins | ||
| Tmem27-1783M | Recombinant Mouse Tmem27 protein, His & GST-tagged | +Inquiry |
| TMEM27-528H | Recombinant Human TMEM27 Protein, His-tagged | +Inquiry |
| Tmem27-1784M | Recombinant Mouse Tmem27 protein, His & T7-tagged | +Inquiry |
| TMEM27-5818R | Recombinant Rat TMEM27 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMEM27-8571H | Recombinant Human TMEM27 protein(Met1-Pro141), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM27-1163HCL | Recombinant Human TMEM27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM27 Products
Required fields are marked with *
My Review for All TMEM27 Products
Required fields are marked with *
