Recombinant Human TMEM30A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM30A-3823H
Product Overview : TMEM30A MS Standard C13 and N15-labeled recombinant protein (NP_060717) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TMEM30A (Transmembrane Protein 30A) is a Protein Coding gene. Diseases associated with TMEM30A include Cholestasis, Benign Recurrent Intrahepatic, 1 and Progressive Familial Intrahepatic Cholestasis. Among its related pathways are Innate Immune System. An important paralog of this gene is TMEM30B.
Molecular Mass : 40.5 kDa
AA Sequence : MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITISGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM30A transmembrane protein 30A [ Homo sapiens (human) ]
Official Symbol TMEM30A
Synonyms TMEM30A; transmembrane protein 30A; CDC50A; C6orf67; cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A
Gene ID 55754
mRNA Refseq NM_018247
Protein Refseq NP_060717
MIM 611028
UniProt ID Q9NV96

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM30A Products

Required fields are marked with *

My Review for All TMEM30A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon