Recombinant Human TMEM30A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMEM30A-3823H |
Product Overview : | TMEM30A MS Standard C13 and N15-labeled recombinant protein (NP_060717) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TMEM30A (Transmembrane Protein 30A) is a Protein Coding gene. Diseases associated with TMEM30A include Cholestasis, Benign Recurrent Intrahepatic, 1 and Progressive Familial Intrahepatic Cholestasis. Among its related pathways are Innate Immune System. An important paralog of this gene is TMEM30B. |
Molecular Mass : | 40.5 kDa |
AA Sequence : | MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITISGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMEM30A transmembrane protein 30A [ Homo sapiens (human) ] |
Official Symbol | TMEM30A |
Synonyms | TMEM30A; transmembrane protein 30A; CDC50A; C6orf67; cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A |
Gene ID | 55754 |
mRNA Refseq | NM_018247 |
Protein Refseq | NP_060717 |
MIM | 611028 |
UniProt ID | Q9NV96 |
◆ Recombinant Proteins | ||
TMEM30A-1821HFL | Recombinant Full Length Human TMEM30A protein, Flag-tagged | +Inquiry |
TMEM30A-3823H | Recombinant Human TMEM30A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMEM30A-9388M | Recombinant Mouse TMEM30A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM30A-155H | Recombinant Human TMEM30A protein, MYC/DDK-tagged | +Inquiry |
TMEM30A-5819R | Recombinant Rat TMEM30A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM30A-688HCL | Recombinant Human TMEM30A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM30A Products
Required fields are marked with *
My Review for All TMEM30A Products
Required fields are marked with *