Recombinant Human TMEM30A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMEM30A-3823H |
Product Overview : | TMEM30A MS Standard C13 and N15-labeled recombinant protein (NP_060717) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TMEM30A (Transmembrane Protein 30A) is a Protein Coding gene. Diseases associated with TMEM30A include Cholestasis, Benign Recurrent Intrahepatic, 1 and Progressive Familial Intrahepatic Cholestasis. Among its related pathways are Innate Immune System. An important paralog of this gene is TMEM30B. |
Molecular Mass : | 40.5 kDa |
AA Sequence : | MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITISGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMEM30A transmembrane protein 30A [ Homo sapiens (human) ] |
Official Symbol | TMEM30A |
Synonyms | TMEM30A; transmembrane protein 30A; CDC50A; C6orf67; cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A |
Gene ID | 55754 |
mRNA Refseq | NM_018247 |
Protein Refseq | NP_060717 |
MIM | 611028 |
UniProt ID | Q9NV96 |
◆ Recombinant Proteins | ||
Tmem30a-6502M | Recombinant Mouse Tmem30a Protein, Myc/DDK-tagged | +Inquiry |
TMEM30A-4633R | Recombinant Rhesus Macaque TMEM30A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM30A-4819R | Recombinant Rhesus monkey TMEM30A Protein, His-tagged | +Inquiry |
TMEM30A-2096C | Recombinant Chicken TMEM30A | +Inquiry |
RFL8353MF | Recombinant Full Length Mouse Cell Cycle Control Protein 50A(Tmem30A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM30A-688HCL | Recombinant Human TMEM30A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM30A Products
Required fields are marked with *
My Review for All TMEM30A Products
Required fields are marked with *