Recombinant Human TMEM30A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM30A-3823H
• Product Overview: TMEM30A MS Standard C13 and N15-labeled recombinant protein (NP_060717) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TMEM30A (Transmembrane Protein 30A) is a Protein Coding gene. Diseases associated with TMEM30A include Cholestasis, Benign Recurrent Intrahepatic, 1 and Progressive Familial Intrahepatic Cholestasis. Among its related pathways are Innate Immune System. An important paralog of this gene is TMEM30B.
• Molecular Mass: 40.5 kDa
• AA Sequence: MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITISGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM30A transmembrane protein 30A [ Homo sapiens (human) ]
• Official Symbol: TMEM30A
• Synonyms: TMEM30A; transmembrane protein 30A; CDC50A; C6orf67; cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A
• Gene ID: 55754
• mRNA Refseq: NM_018247
• Protein Refseq: NP_060717
• MIM: 611028
• UniProt ID: Q9NV96