Recombinant Human TMEM91 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM91-406H
Product Overview : TMEM91 MS Standard C13 and N15-labeled recombinant protein (NP_001092291) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Broad expression in bone marrow (RPKM 6.3), testis (RPKM 5.0) and 25 other tissues
Molecular Mass : 18 kDa
AA Sequence : MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQKTNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM91 transmembrane protein 91 [ Homo sapiens (human) ]
Official Symbol TMEM91
Synonyms TMEM91; transmembrane protein 91; FLJ27310; IFITMD6; interferon induced transmembrane protein domain containing 6; FLJ45695;
Gene ID 641649
mRNA Refseq NM_001098821
Protein Refseq NP_001092291
MIM 618294
UniProt ID Q6ZNR0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM91 Products

Required fields are marked with *

My Review for All TMEM91 Products

Required fields are marked with *

0
cart-icon