Recombinant Human TMEM91 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMEM91-406H |
Product Overview : | TMEM91 MS Standard C13 and N15-labeled recombinant protein (NP_001092291) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Broad expression in bone marrow (RPKM 6.3), testis (RPKM 5.0) and 25 other tissues |
Molecular Mass : | 18 kDa |
AA Sequence : | MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQKTNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMEM91 transmembrane protein 91 [ Homo sapiens (human) ] |
Official Symbol | TMEM91 |
Synonyms | TMEM91; transmembrane protein 91; FLJ27310; IFITMD6; interferon induced transmembrane protein domain containing 6; FLJ45695; |
Gene ID | 641649 |
mRNA Refseq | NM_001098821 |
Protein Refseq | NP_001092291 |
MIM | 618294 |
UniProt ID | Q6ZNR0 |
◆ Recombinant Proteins | ||
TMEM91-406H | Recombinant Human TMEM91 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL8601HF | Recombinant Full Length Human Transmembrane Protein 91(Tmem91) Protein, His-Tagged | +Inquiry |
TMEM91-4659R | Recombinant Rhesus Macaque TMEM91 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM91-4845R | Recombinant Rhesus monkey TMEM91 Protein, His-tagged | +Inquiry |
Tmem91-6518M | Recombinant Mouse Tmem91 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM91 Products
Required fields are marked with *
My Review for All TMEM91 Products
Required fields are marked with *