Recombinant Human TMEM91 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM91-406H
• Product Overview: TMEM91 MS Standard C13 and N15-labeled recombinant protein (NP_001092291) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Broad expression in bone marrow (RPKM 6.3), testis (RPKM 5.0) and 25 other tissues
• Molecular Mass: 18 kDa
• AA Sequence: MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQKTNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM91 transmembrane protein 91 [ Homo sapiens (human) ]
• Official Symbol: TMEM91
• Synonyms: TMEM91; transmembrane protein 91; FLJ27310; IFITMD6; interferon induced transmembrane protein domain containing 6; FLJ45695
• Gene ID: 641649
• mRNA Refseq: NM_001098821
• Protein Refseq: NP_001092291
• MIM: 618294
• UniProt ID: Q6ZNR0