Recombinant Human TMPRSS2
Cat.No. : | TMPRSS2-30144TH |
Product Overview : | Recombinant fragment of Human TMPRSS2 with a proprietary tag; predicted mwt: 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Expressed strongly in small intestine. Also expressed in prostate, colon, stomach and salivary gland. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
Sequence Similarities : | Belongs to the peptidase S1 family.Contains 1 LDL-receptor class A domain.Contains 1 peptidase S1 domain.Contains 1 SRCR domain. |
Gene Name | TMPRSS2 transmembrane protease, serine 2 [ Homo sapiens ] |
Official Symbol | TMPRSS2 |
Synonyms | TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; PRSS10; |
Gene ID | 7113 |
mRNA Refseq | NM_005656 |
Protein Refseq | NP_005647 |
MIM | 602060 |
Uniprot ID | O15393 |
Chromosome Location | 21q22.3 |
Pathway | Coregulation of Androgen receptor activity, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Regulation of Androgen receptor activity, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; |
Function | peptidase activity; scavenger receptor activity; serine-type endopeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
TMPRSS2-70H | Recombinant Human TMPRSS2 protein, GST-tagged | +Inquiry |
Tmprss2-8078M | Recombinant Mouse Tmprss2 protein, His & T7-tagged | +Inquiry |
Tmprss2-429R | Recombinant Rat Tmprss2 Protein, His-tagged | +Inquiry |
TMPRSS2-4592H | Recombinant Human TMPRSS2 protein, MBP&His-Avi-tagged | +Inquiry |
TMPRSS2-8077H | Recombinant Human TMPRSS2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TMPRSS2-011H | Recombinant Human TMPRSS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *
0
Inquiry Basket