Recombinant Human TMUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TMUB1-2444H |
| Product Overview : | TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129516) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. Involved in positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface. Acts as negative regulator of hepatocyte growth during regeneration. |
| Molecular Mass : | 26.1 kDa |
| AA Sequence : | MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TMUB1 transmembrane and ubiquitin-like domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | TMUB1 |
| Synonyms | TMUB1; transmembrane and ubiquitin-like domain containing 1; C7orf21, chromosome 7 open reading frame 21; transmembrane and ubiquitin-like domain-containing protein 1; SB144; ubiquitin-like protein DULP; ubiquitin-like protein SB144; hepatocyte odd protein shuttling protein; C7orf21; MGC5442; |
| Gene ID | 83590 |
| mRNA Refseq | NM_001136044 |
| Protein Refseq | NP_001129516 |
| MIM | 614792 |
| UniProt ID | Q9BVT8 |
| ◆ Recombinant Proteins | ||
| TMUB1-6190R | Recombinant Rat TMUB1 Protein | +Inquiry |
| TMUB1-5847R | Recombinant Rat TMUB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMUB1-17136M | Recombinant Mouse TMUB1 Protein | +Inquiry |
| RFL6259RF | Recombinant Full Length Rat Transmembrane And Ubiquitin-Like Domain-Containing Protein 1(Tmub1) Protein, His-Tagged | +Inquiry |
| TMUB1-4856R | Recombinant Rhesus monkey TMUB1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMUB1-1800HCL | Recombinant Human TMUB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMUB1 Products
Required fields are marked with *
My Review for All TMUB1 Products
Required fields are marked with *
