Recombinant Human TMUB2 protein, His-tagged
Cat.No. : | TMUB2-8964H |
Product Overview : | Recombinant Human TMUB2 protein(101-230 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 101-230 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | HPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | TMUB2 |
Synonyms | TMUB2; transmembrane and ubiquitin-like domain containing 2; transmembrane and ubiquitin-like domain-containing protein 2; MGC3123; FP2653; |
Gene ID | 79089 |
mRNA Refseq | NM_001076674 |
Protein Refseq | NP_001070142 |
UniProt ID | Q71RG4 |
◆ Recombinant Proteins | ||
TMUB2-17137M | Recombinant Mouse TMUB2 Protein | +Inquiry |
TMUB2-5848R | Recombinant Rat TMUB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMUB2-9465M | Recombinant Mouse TMUB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18188HF | Recombinant Full Length Human Transmembrane And Ubiquitin-Like Domain-Containing Protein 2(Tmub2) Protein, His-Tagged | +Inquiry |
TMUB2-1417Z | Recombinant Zebrafish TMUB2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMUB2-786HCL | Recombinant Human TMUB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMUB2 Products
Required fields are marked with *
My Review for All TMUB2 Products
Required fields are marked with *
0
Inquiry Basket