Recombinant Human TNF protein

Cat.No. : TNF-38H
Product Overview : Recombinant Human TNF protein (variant) was expressed in Escherichia coli. Compared with wild type, this variant has an amino acid sequence (a.a.) deletion from a.a. 1-7, and the following a.a. substitutes Arg8, Lys9, Arg10 and Phe157 which is proven to have more activity and with less inflammatory side effect in vivo.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 151
Description : The clinical use of the potent antitumor activity of TNF-αhas been limited by the proinflammatory side effects including fever, dose-limiting hypotension, hepatotoxicity, intravascular thrombosis, and hemorrhage. Designing clinically applicable TNF-αmutants with low systemic toxicity has been an intense pharmacological interest. Human TNF-α, which binds to the murine TNF-R55 but not to the murine TNF-R75, exhibits retained antitumor activity and reduced systemic toxicity in mice compared with murine TNF-α, which binds to both murine TNF receptors. Based on these results, many TNF-αmutants that selectively bind to TNF-R55 have been designed. These mutants displayed cytotoxic activities on tumor cell lines in vitro, and exhibited lower systemic toxicity in vivo.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.0.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg in the presence of actinomycin D.
Molecular Mass : Approximately 16.9 kDa, a single non-glycosylated polypeptide chain containing 151 amino acids. Compared with the wild-type, rHuTNF-α Variant has an amino acid sequence (a.a.) deletion from a.a. 1-7, and the following a.a. substitutes Arg8, Lys9, Arg10 and Phe157 which is proven to have more activity and with less inflammatory side effect in vivo.
AA Sequence : MRKRKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAF
Endotoxin : Less than 1 EU/μg of rHu TNF-α/TNFSF2, Variant as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TNF
Official Symbol TNF
Synonyms TNF; tumor necrosis factor; TNFA, tumor necrosis factor (TNF superfamily, member 2); DIF; TNF superfamily; member 2; TNF alpha; TNFSF2; TNF-a; cachectin; APC1 protein; TNF, monocyte-derived; TNF, macrophage-derived; TNF superfamily, member 2; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; TNFA; TNF-alpha;
Gene ID 7124
mRNA Refseq NM_000594
Protein Refseq NP_000585
MIM 191160
UniProt ID P01375

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNF Products

Required fields are marked with *

My Review for All TNF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon