Recombinant Human TNFAIP6 protein, GST-tagged
Cat.No. : | TNFAIP6-3005H |
Product Overview : | Recombinant Human TNFAIP6(1 a.a. - 277 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-277 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAAR KIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPG FPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVM TLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TNFAIP6 tumor necrosis factor, alpha-induced protein 6 [ Homo sapiens ] |
Official Symbol | TNFAIP6 |
Synonyms | TNFAIP6; tumor necrosis factor, alpha-induced protein 6; tumor necrosis factor-inducible gene 6 protein; TSG 6; TSG6; TNF alpha-induced protein 6; hyaluronate-binding protein; TNF-stimulated gene 6 protein; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor-stimulated gene-6 protein; TSG-6; |
Gene ID | 7130 |
mRNA Refseq | NM_007115 |
Protein Refseq | NP_009046 |
MIM | 600410 |
UniProt ID | P98066 |
Chromosome Location | 2q23.3 |
Function | binding; hyaluronic acid binding; |
◆ Recombinant Proteins | ||
TNFAIP6-17146M | Recombinant Mouse TNFAIP6 Protein | +Inquiry |
Tnfaip6-916M | Active Recombinant Mouse Tnfaip6 Protein, His-tagged | +Inquiry |
Tnfaip6-1417M | Recombinant Mouse Tnfaip6 protein, His & T7-tagged | +Inquiry |
TNFAIP6-3004H | Recombinant Human Tumor Necrosis Factor, Alpha-Induced Protein 6, His-tagged | +Inquiry |
TNFAIP6-578HF | Recombinant Full Length Human TNFAIP6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFAIP6-896HCL | Recombinant Human TNFAIP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFAIP6 Products
Required fields are marked with *
My Review for All TNFAIP6 Products
Required fields are marked with *