"TNFAIP6" Related Products

Expand
Expand
Expand

Recombinant Human TNFAIP6 protein, GST-tagged

Cat.No.: TNFAIP6-3005H
Product Overview: Recombinant Human TNFAIP6(1 a.a. - 277 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 57.6 kDa
AA Sequence: MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAAR KIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPG FPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVM TLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: TNFAIP6 tumor necrosis factor, alpha-induced protein 6 [ Homo sapiens ]
Official Symbol: TNFAIP6
Synonyms: TNFAIP6; tumor necrosis factor, alpha-induced protein 6; tumor necrosis factor-inducible gene 6 protein; TSG 6; TSG6; TNF alpha-induced protein 6; hyaluronate-binding protein; TNF-stimulated gene 6 protein; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor-stimulated gene-6 protein; TSG-6;
Gene ID: 7130
mRNA Refseq: NM_007115
Protein Refseq: NP_009046
MIM: 600410
UniProt ID: P98066
Chromosome Location: 2q23.3
Function: binding; hyaluronic acid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.