Recombinant Human TNFAIP6 protein, GST-tagged
| Cat.No. : | TNFAIP6-3005H |
| Product Overview : | Recombinant Human TNFAIP6(1 a.a. - 277 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-277 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 57.6 kDa |
| AA Sequence : | MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAAR KIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPG FPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVM TLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TNFAIP6 tumor necrosis factor, alpha-induced protein 6 [ Homo sapiens ] |
| Official Symbol | TNFAIP6 |
| Synonyms | TNFAIP6; tumor necrosis factor, alpha-induced protein 6; tumor necrosis factor-inducible gene 6 protein; TSG 6; TSG6; TNF alpha-induced protein 6; hyaluronate-binding protein; TNF-stimulated gene 6 protein; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor-stimulated gene-6 protein; TSG-6; |
| Gene ID | 7130 |
| mRNA Refseq | NM_007115 |
| Protein Refseq | NP_009046 |
| MIM | 600410 |
| UniProt ID | P98066 |
| Chromosome Location | 2q23.3 |
| Function | binding; hyaluronic acid binding; |
| ◆ Recombinant Proteins | ||
| TNFAIP6-578HF | Recombinant Full Length Human TNFAIP6 Protein, GST-tagged | +Inquiry |
| TNFAIP6-3306C | Recombinant Chicken TNFAIP6 | +Inquiry |
| TNFAIP6-3315H | Recombinant Human TNFAIP6, His-tagged | +Inquiry |
| Tnfaip6-1417M | Recombinant Mouse Tnfaip6 protein, His & T7-tagged | +Inquiry |
| TNFAIP6-9470M | Recombinant Mouse TNFAIP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFAIP6-896HCL | Recombinant Human TNFAIP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFAIP6 Products
Required fields are marked with *
My Review for All TNFAIP6 Products
Required fields are marked with *



