Recombinant Human TNFAIP6 protein, GST-tagged

Cat.No. : TNFAIP6-3005H
Product Overview : Recombinant Human TNFAIP6(1 a.a. - 277 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-277 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 57.6 kDa
AA Sequence : MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAAR KIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPG FPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVM TLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TNFAIP6 tumor necrosis factor, alpha-induced protein 6 [ Homo sapiens ]
Official Symbol TNFAIP6
Synonyms TNFAIP6; tumor necrosis factor, alpha-induced protein 6; tumor necrosis factor-inducible gene 6 protein; TSG 6; TSG6; TNF alpha-induced protein 6; hyaluronate-binding protein; TNF-stimulated gene 6 protein; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor-stimulated gene-6 protein; TSG-6;
Gene ID 7130
mRNA Refseq NM_007115
Protein Refseq NP_009046
MIM 600410
UniProt ID P98066
Chromosome Location 2q23.3
Function binding; hyaluronic acid binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFAIP6 Products

Required fields are marked with *

My Review for All TNFAIP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon