Recombinant Human TNFRSF10B Protein, C-His-tagged

Cat.No. : TNFRSF10B-156H
Product Overview : Recombinant Human TNFRSF10B Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The tumor necrosis factor receptor family, which includes TNF-RI, Fas, DR3, DR4, DR5, and DR6, plays an important role in the regulation of apoptosis in various physiological systems. The receptors are activated by a family of cytokines that include TNF, FasL, and TNF-related apoptosis-inducing ligand (TRAIL). They are characterized by a highly conserved extracellular region containing cysteine-rich repeats and a conserved intracellular region of about 80 amino acids termed the death domain (DD). The DD is important for transducing the death signal by recruiting other DD containing adaptor proteins (FADD, TRADD, RIP) to the death-inducing signaling complex (DISC), resulting in activation of caspases. DR5 is a receptor for TNF-related apoptosis inducing ligand (TRAIL), which has been shown to induce apoptosis in a variety of cell types and has been targeted for cancer therapy. Structurally, DR5 contains an amino-terminal leader cleavage site, followed by an extracellular region containing two cysteine-rich repeats, a central transmembrane domain, and a carboxy-terminal DD. DR5 is expressed in a wide variety of tissues and is a transcriptional target of p53. It induces apoptosis through a FADD-dependent pathway. Deletion of DR5 leads to resistance in TRAIL-mediated apoptosis as well as an abrogated response to DNA-damaging stimuli. At least two isoforms of DR5 are produced by alternative splicing.
Molecular Mass : ~17 kDa
AA Sequence : ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPGTPASPCS
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name TNFRSF10B tumor necrosis factor receptor superfamily, member 10b [ Homo sapiens (human) ]
Official Symbol TNFRSF10B
Synonyms TNFRSF10B; tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor superfamily member 10B; CD262; DR5; KILLER; TRAIL R2; TRICK2A; TRICKB; Fas-like protein; death receptor 5; cytotoxic TRAIL receptor-2; apoptosis inducing receptor TRAIL-R2; apoptosis inducing protein TRICK2A/2B; TNF-related apoptosis-inducing ligand receptor 2; death domain containing receptor for TRAIL/Apo-2L; tumor necrosis factor receptor-like protein ZTNFR9; p53-regulated DNA damage-inducible cell death receptor(killer); TRICK2; ZTNFR9; TRAILR2; TRICK2B; TRAIL-R2; KILLER/DR5;
Gene ID 8795
mRNA Refseq NM_003842
Protein Refseq NP_003833
MIM 603612
UniProt ID O14763

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF10B Products

Required fields are marked with *

My Review for All TNFRSF10B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon