Recombinant Human TNFRSF11A protein, GST-tagged
Cat.No. : | TNFRSF11A-301530H |
Product Overview : | Recombinant Human TNFRSF11A (33-205 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro33-Asn205 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Homo sapiens ] |
Official Symbol | TNFRSF11A |
Synonyms | TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1; |
Gene ID | 8792 |
mRNA Refseq | NM_003839 |
Protein Refseq | NP_003830 |
MIM | 603499 |
UniProt ID | Q9Y6Q6 |
◆ Recombinant Proteins | ||
TNFRSF11A-1084R | Recombinant Rat TNFRSF11A Protein, Fc-tagged | +Inquiry |
TNFRSF11A-1333H | Recombinant Human TNFRSF11A Protein (Tyr76-Pro317), N-His tagged | +Inquiry |
TNFRSF11A-401H | Recombinant Human TNFRSF11A, His-tagged | +Inquiry |
Tnfrsf11a-10622M | Recombinant Mouse Tnfrsf11a Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF11A-1644R | Recombinant Rhesus Monkey TNFRSF11A Protein, hIgG4-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF11A-1413RCL | Recombinant Rat TNFRSF11A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF11A Products
Required fields are marked with *
My Review for All TNFRSF11A Products
Required fields are marked with *