Recombinant Human TNFRSF11A protein, hFc-Flag-tagged

Cat.No. : TNFRSF11A-5743H
Product Overview : Recombinant Human TNFRSF11A protein(Q9Y6Q6)(30-212aa), fused with C-terminal hFc and Flag tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&Flag
Protein Length : 30-212aa
Tag : C-hFc-Flag
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50.0 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
Gene Name TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Homo sapiens ]
Official Symbol TNFRSF11A
Synonyms TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1;
Gene ID 8792
mRNA Refseq NM_003839
Protein Refseq NP_003830
MIM 603499
UniProt ID Q9Y6Q6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF11A Products

Required fields are marked with *

My Review for All TNFRSF11A Products

Required fields are marked with *

0
cart-icon
0
compare icon