Recombinant Human TNFRSF11A protein, hFc-Flag-tagged
| Cat.No. : | TNFRSF11A-5743H |
| Product Overview : | Recombinant Human TNFRSF11A protein(Q9Y6Q6)(30-212aa), fused with C-terminal hFc and Flag tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&Flag |
| Protein Length : | 30-212aa |
| Tag : | C-hFc-Flag |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP |
| Gene Name | TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Homo sapiens ] |
| Official Symbol | TNFRSF11A |
| Synonyms | TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1; |
| Gene ID | 8792 |
| mRNA Refseq | NM_003839 |
| Protein Refseq | NP_003830 |
| MIM | 603499 |
| UniProt ID | Q9Y6Q6 |
| ◆ Recombinant Proteins | ||
| TNFRSF11A-591H | Active Recombinant Human TNFRSF11A protein | +Inquiry |
| Tnfrsf11a-6785M | Recombinant Mouse Tnfrsf11a Protein (Val31-Ser214), C-His tagged | +Inquiry |
| TNFRSF11A-401H | Recombinant Human TNFRSF11A, His-tagged | +Inquiry |
| TNFRSF11A-1997H | Recombinant Human TNFRSF11A Protein | +Inquiry |
| Tnfrsf11a-186R | Recombinant Rat Tnfrsf11a Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF11A-1413RCL | Recombinant Rat TNFRSF11A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF11A Products
Required fields are marked with *
My Review for All TNFRSF11A Products
Required fields are marked with *



