Active Recombinant Human TNFRSF11A protein
Cat.No. : | TNFRSF11A-591H |
Product Overview : | Recombinant Human TNFRSF11A protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 174 |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.0, 150mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit sRANK Ligand induced nuclear factor kappa B(NFkappaB) in RAW 264.7 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg in the presence of 15 ng/ml of recombinant sRANK Ligand. |
Molecular Mass : | Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids. |
AA Sequence : | QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK |
Endotoxin : | Less than 0.1 EU/μg of rHusRANK Receptor as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF11A |
Official Symbol | TNFRSF11A |
Synonyms | TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1; |
Gene ID | 8792 |
mRNA Refseq | NM_003839 |
Protein Refseq | NP_003830 |
MIM | 603499 |
UniProt ID | Q9Y6Q6 |
◆ Recombinant Proteins | ||
Tnfrsf11a-1775M | Recombinant Mouse Tnfrsf11a | +Inquiry |
TNFRSF11A-1084R | Recombinant Rat TNFRSF11A Protein, Fc-tagged | +Inquiry |
TNFRSF11A-400H | Active Recombinant Human TNFRSF11A protein, hFc-tagged | +Inquiry |
TNFRSF11A-5743H | Recombinant Human TNFRSF11A protein, hFc-Flag-tagged | +Inquiry |
Tnfrsf11a-955M | Active Recombinant Mouse Tnfrsf11a Protein, Fc Chimera | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF11A-1413RCL | Recombinant Rat TNFRSF11A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF11A Products
Required fields are marked with *
My Review for All TNFRSF11A Products
Required fields are marked with *