Active Recombinant Human TNFRSF11B Protein, His tagged

Cat.No. : TNFRSF11B-169H
Product Overview : Recombinant human osteoprotegerin protein, fused to His-tag at C-terminus, was expressed in Hi-5 cell using baculovirus expression system and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 22-401aa
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined.
Form : Liquid
Bio-activity : Measured by its ability to inhibit cytotoxicity using Jurkat human acute T cell leukemia cells in the presence of 2 ng/mL of human TRAIL. The ED50 range ≤ 8 ng/mL.
Molecular Mass : 44.7 kDa
AA Sequence : ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Endotoxin : <1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 0.5 mg/mL (determined by Bradford assay)
Reference : 1. Lacey, D.L. et al. (1998) Cell 93:165-76 2. Yasuda H. et al. (1998) PNAS 95:3597-602 3. A. Van Campenhout, Golledge J. (2009) Atherosclerosis 204:321-29
Gene Name TNFRSF11B tumor necrosis factor receptor superfamily, member 11b [ Homo sapiens (human) ]
Official Symbol TNFRSF11B
Synonyms TNFRSF11B; tumor necrosis factor receptor superfamily, member 11b; OPG, osteoprotegerin; tumor necrosis factor receptor superfamily member 11B; OCIF; TR1; osteoprotegerin; osteoclastogenesis inhibitory factor; OPG; MGC29565
Gene ID 4982
mRNA Refseq NM_002546
Protein Refseq NP_002537
MIM 602643
UniProt ID O00300

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF11B Products

Required fields are marked with *

My Review for All TNFRSF11B Products

Required fields are marked with *

0
cart-icon