Recombinant Human TNFRSF13B, Fc-tagged
| Cat.No. : | TNFRSF13B-26H |
| Product Overview : | Recombinant Human TNFRSF13B, fused to Fc-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Description : | The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Form : | PBS, pH7.4 |
| Molecular Mass : | 35.3 kDa |
| AA Sequence : | AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1EU/ug by LAL. |
| Purity : | >95% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.12mg/ml |
| Gene Name | TNFRSF13B TNF receptor superfamily member 13B [ Homo sapiens (human) ] |
| Official Symbol | TNFRSF13B |
| Synonyms | CVID; RYZN; TACI; CD267; CVID2; IGAD2; TNFRSF14B |
| Gene ID | 23495 |
| mRNA Refseq | NM_012452 |
| Protein Refseq | NP_036584 |
| MIM | 604907 |
| UniProt ID | O14836 |
| ◆ Recombinant Proteins | ||
| TNFRSF13B-359H | Recombinant Human TNFRSF13B protein, Fc-tagged | +Inquiry |
| TNFRSF13B-2095H | Recombinant Human TNFRSF13B, Fc-tagged | +Inquiry |
| TNFRSF13B-345C | Recombinant Cynomolgus TNFRSF13B protein, His-tagged | +Inquiry |
| TNFRSF13B-147H | Recombinant Human TNFRSF13B Protein, His (Fc)-Avi-tagged | +Inquiry |
| TNFRSF13B-1683H | Recombinant Human TNFRSF13B, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF13B-1916HCL | Recombinant Human TNFRSF13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF13B Products
Required fields are marked with *
My Review for All TNFRSF13B Products
Required fields are marked with *
