Recombinant Human TNFRSF13B, Fc-tagged
Cat.No. : | TNFRSF13B-26H |
Product Overview : | Recombinant Human TNFRSF13B, fused to Fc-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. |
Form : | PBS, pH7.4 |
Molecular Mass : | 35.3 kDa |
AA Sequence : | AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1EU/ug by LAL. |
Purity : | >95% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.12mg/ml |
Gene Name | TNFRSF13B TNF receptor superfamily member 13B [ Homo sapiens (human) ] |
Official Symbol | TNFRSF13B |
Synonyms | CVID; RYZN; TACI; CD267; CVID2; IGAD2; TNFRSF14B |
Gene ID | 23495 |
mRNA Refseq | NM_012452 |
Protein Refseq | NP_036584 |
MIM | 604907 |
UniProt ID | O14836 |
◆ Recombinant Proteins | ||
TNFRSF13B-3320H | Recombinant Human TNFRSF13B, GST-tagged | +Inquiry |
TNFRSF13B-151H | Recombinant Human TNFRSF13B Protein, DYKDDDDK-tagged | +Inquiry |
TNFRSF13B-7545H | Recombinant Human TNFRSF13B, His-tagged | +Inquiry |
TNFRSF13B-26H | Recombinant Human TNFRSF13B, Fc-tagged | +Inquiry |
TNFRSF13B-970H | Recombinant Human TNFRSF13B protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13B-1916HCL | Recombinant Human TNFRSF13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF13B Products
Required fields are marked with *
My Review for All TNFRSF13B Products
Required fields are marked with *