Recombinant Human TNFRSF25 protein, His-tagged

• Cat.No.: TNFRSF25-4680H
• Product Overview: Recombinant Human TNFRSF25 protein(Q93038)(25-199 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 25-199 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 20.4 kDa
• AASequence: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: TNFRSF25 tumor necrosis factor receptor superfamily, member 25 [ Homo sapiens ]
• Official Symbol: TNFRSF25
• Synonyms: TNFRSF25; tumor necrosis factor receptor superfamily, member 25; TNFRSF12, tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein); tumor necrosis factor receptor superfamily member 25; APO 3; DDR3; DR3; LARD; TR3; TRAMP; WSL 1; WSL LR; protein WSL-1; death receptor beta; apoptosis inducing receptor; apoptosis-inducing receptor AIR; apoptosis-mediating receptor DR3; apoptosis-mediating receptor TRAMP; death domain receptor 3 soluble form; lymphocyte-associated receptor of death; tumor necrosis factor receptor superfamily, member 12 (translocating chain-association membrane protein); APO-3; WSL-1; WSL-LR; TNFRSF12
• Gene ID: 8718
• mRNA Refseq: NM_001039664
• Protein Refseq: NP_001034753
• MIM: 603366
• UniProt ID: Q93038