Recombinant Human TNFRSF25 protein, His-tagged
Cat.No. : | TNFRSF25-4680H |
Product Overview : | Recombinant Human TNFRSF25 protein(Q93038)(25-199 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 25-199 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 20.4 kDa |
AASequence : | QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | TNFRSF25 tumor necrosis factor receptor superfamily, member 25 [ Homo sapiens ] |
Official Symbol | TNFRSF25 |
Synonyms | TNFRSF25; tumor necrosis factor receptor superfamily, member 25; TNFRSF12, tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein); tumor necrosis factor receptor superfamily member 25; APO 3; DDR3; DR3; LARD; TR3; TRAMP; WSL 1; WSL LR; protein WSL-1; death receptor beta; apoptosis inducing receptor; apoptosis-inducing receptor AIR; apoptosis-mediating receptor DR3; apoptosis-mediating receptor TRAMP; death domain receptor 3 soluble form; lymphocyte-associated receptor of death; tumor necrosis factor receptor superfamily, member 12 (translocating chain-association membrane protein); APO-3; WSL-1; WSL-LR; TNFRSF12; |
Gene ID | 8718 |
mRNA Refseq | NM_001039664 |
Protein Refseq | NP_001034753 |
MIM | 603366 |
UniProt ID | Q93038 |
◆ Recombinant Proteins | ||
TNFRSF25-449H | Recombinant Human TNFRSF25 Protein, His-tagged | +Inquiry |
TNFRSF25-596H | Active Recombinant Human TNFRSF25, Fc-tagged, Biotinylated | +Inquiry |
TNFRSF25-2142H | Recombinant Human TNFRSF25 protein, His-tagged | +Inquiry |
TNFRSF25-205H | Recombinant Human TNFRSF25 Protein, Fc-tagged | +Inquiry |
TNFRSF25-369C | Recombinant Cynomolgus TNFRSF25 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF25-2154HCL | Recombinant Human TNFRSF25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF25 Products
Required fields are marked with *
My Review for All TNFRSF25 Products
Required fields are marked with *
0
Inquiry Basket