Recombinant Human TNFRSF25 protein, His-tagged

Cat.No. : TNFRSF25-4680H
Product Overview : Recombinant Human TNFRSF25 protein(Q93038)(25-199 aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 25-199 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 20.4 kDa
AASequence : QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name TNFRSF25 tumor necrosis factor receptor superfamily, member 25 [ Homo sapiens ]
Official Symbol TNFRSF25
Synonyms TNFRSF25; tumor necrosis factor receptor superfamily, member 25; TNFRSF12, tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein); tumor necrosis factor receptor superfamily member 25; APO 3; DDR3; DR3; LARD; TR3; TRAMP; WSL 1; WSL LR; protein WSL-1; death receptor beta; apoptosis inducing receptor; apoptosis-inducing receptor AIR; apoptosis-mediating receptor DR3; apoptosis-mediating receptor TRAMP; death domain receptor 3 soluble form; lymphocyte-associated receptor of death; tumor necrosis factor receptor superfamily, member 12 (translocating chain-association membrane protein); APO-3; WSL-1; WSL-LR; TNFRSF12;
Gene ID 8718
mRNA Refseq NM_001039664
Protein Refseq NP_001034753
MIM 603366
UniProt ID Q93038

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF25 Products

Required fields are marked with *

My Review for All TNFRSF25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon