Recombinant Human TNFRSF9 Protein, C-His-tagged
| Cat.No. : | TNFRSF9-076H |
| Product Overview : | Recombinant Human TNFRSF9 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | TNFRSF9 is a member of the tumor necrosis factor receptor superfamily. It is also called 4-1BB or CD137. 4-1BB/CD137/TNFRSF9 is expressed in activated CD4+ and CD8+ T cells, natural killer cells and dendritic cells. The ligand 4-1BBL/CD137L/TNFSF9 on antigen presenting cells binds to 4-1BB/CD137/TNFRSF9 and costimulates the activation of T cells. The binding of agonistic antibodies to 4-1BB/CD137/TNFRSF9 also leads to costimulation for T cell activation. Studies have shown the effectiveness of targeting 4-1BB/CD137/TNFRSF9 by its agonistic antibodies in cancer immunotherapy. |
| Molecular Mass : | ~18 kDa |
| AA Sequence : | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | TNFRSF9 tumor necrosis factor receptor superfamily, member 9 [ Homo sapiens (human) ] |
| Official Symbol | TNFRSF9 |
| Synonyms | TNFRSF9; tumor necrosis factor receptor superfamily, member 9; ILA; tumor necrosis factor receptor superfamily member 9; 4 1BB; CD137; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; 4-1BB; CDw137; MGC2172; FLJ43501; |
| Gene ID | 3604 |
| mRNA Refseq | NM_001561 |
| Protein Refseq | NP_001552 |
| MIM | 602250 |
| UniProt ID | Q07011 |
| ◆ Recombinant Proteins | ||
| TNFRSF9-257CAF647 | Recombinant Canine TNFRSF9 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| TNFRSF9-328H | Recombinant Human TNFRSF9 Protein (Met1-Gln186), His-Fc-tagged, Biotinylated | +Inquiry |
| TNFRSF9-110H | Active Recombinant Human TNFRSF9 Protein | +Inquiry |
| TNFRSF9-1512H | Recombinant Human TNFRSF9 Protein (Leu24-Gln186), N-His tagged | +Inquiry |
| TNFRSF9-550RAF488 | Active Recombinant Monkey TNFRSF9 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
| TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
| TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF9 Products
Required fields are marked with *
My Review for All TNFRSF9 Products
Required fields are marked with *
