Recombinant Human TNFRSF9 Protein, C-His-tagged
Cat.No. : | TNFRSF9-076H |
Product Overview : | Recombinant Human TNFRSF9 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | TNFRSF9 is a member of the tumor necrosis factor receptor superfamily. It is also called 4-1BB or CD137. 4-1BB/CD137/TNFRSF9 is expressed in activated CD4+ and CD8+ T cells, natural killer cells and dendritic cells. The ligand 4-1BBL/CD137L/TNFSF9 on antigen presenting cells binds to 4-1BB/CD137/TNFRSF9 and costimulates the activation of T cells. The binding of agonistic antibodies to 4-1BB/CD137/TNFRSF9 also leads to costimulation for T cell activation. Studies have shown the effectiveness of targeting 4-1BB/CD137/TNFRSF9 by its agonistic antibodies in cancer immunotherapy. |
Molecular Mass : | ~18 kDa |
AA Sequence : | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | TNFRSF9 tumor necrosis factor receptor superfamily, member 9 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF9 |
Synonyms | TNFRSF9; tumor necrosis factor receptor superfamily, member 9; ILA; tumor necrosis factor receptor superfamily member 9; 4 1BB; CD137; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; 4-1BB; CDw137; MGC2172; FLJ43501; |
Gene ID | 3604 |
mRNA Refseq | NM_001561 |
Protein Refseq | NP_001552 |
MIM | 602250 |
UniProt ID | Q07011 |
◆ Recombinant Proteins | ||
TNFRSF9-39H | Recombinant Human TNFRSF9 Protein, hIgG-His-tagged | +Inquiry |
TNFRSF9-551H | Recombinant Human TNFRSF9 protein, His-Avi-tagged, Biotinylated | +Inquiry |
TNFRSF9-495M | Recombinant Mouse TNFRSF9 Protein, His-Avi-tagged | +Inquiry |
TNFRSF9-1271H | Active Recombinant Human TNFRSF9 protein, hFc&His-tagged | +Inquiry |
TNFRSF9-1052CAF555 | Recombinant Canine TNFRSF9 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF9 Products
Required fields are marked with *
My Review for All TNFRSF9 Products
Required fields are marked with *
0
Inquiry Basket