Recombinant Human TNFRSF9 protein, GST-tagged
Cat.No. : | TNFRSF9-301562H |
Product Overview : | Recombinant Human TNFRSF9 (16-186 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu16-Gln186 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TNFRSF9 tumor necrosis factor receptor superfamily, member 9 [ Homo sapiens ] |
Official Symbol | TNFRSF9 |
Synonyms | TNFRSF9; tumor necrosis factor receptor superfamily, member 9; ILA; tumor necrosis factor receptor superfamily member 9; 4 1BB; CD137; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; 4-1BB; CDw137; MGC2172; FLJ43501; |
Gene ID | 3604 |
mRNA Refseq | NM_001561 |
Protein Refseq | NP_001552 |
MIM | 602250 |
UniProt ID | Q07011 |
◆ Recombinant Proteins | ||
Tnfrsf9-635MAF488 | Recombinant Mouse Tnfrsf9 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFRSF9-4684R | Recombinant Rhesus Macaque TNFRSF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF9-1233C | Recombinant Cynomolgus/Rhesus macaque TNFRSF9 protein, His-tagged | +Inquiry |
TNFRSF9-3636H | Recombinant Human TNFRSF9 protein, hFc-Avi-tagged | +Inquiry |
Tnfrsf9-635MF | Recombinant Mouse Tnfrsf9 Protein, Fc-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF9 Products
Required fields are marked with *
My Review for All TNFRSF9 Products
Required fields are marked with *