Recombinant Human TNFRSF9 protein, GST-tagged

Cat.No. : TNFRSF9-301562H
Product Overview : Recombinant Human TNFRSF9 (16-186 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Leu16-Gln186
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : LNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TNFRSF9 tumor necrosis factor receptor superfamily, member 9 [ Homo sapiens ]
Official Symbol TNFRSF9
Synonyms TNFRSF9; tumor necrosis factor receptor superfamily, member 9; ILA; tumor necrosis factor receptor superfamily member 9; 4 1BB; CD137; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; 4-1BB; CDw137; MGC2172; FLJ43501;
Gene ID 3604
mRNA Refseq NM_001561
Protein Refseq NP_001552
MIM 602250
UniProt ID Q07011

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF9 Products

Required fields are marked with *

My Review for All TNFRSF9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon