Recombinant Human TNFSF4 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | TNFSF4-086H |
Product Overview : | TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TNFSF4 TNF superfamily member 4 [ Homo sapiens (human) ] |
Official Symbol | TNFSF4 |
Synonyms | TNFSF4; TNF superfamily member 4; CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1; tumor necrosis factor ligand superfamily member 4; CD134 ligand; OX40 antigen ligand; glycoprotein Gp34; tax-transcriptionally activated glycoprotein 1 (34kD); tumor necrosis factor (ligand) superfamily member 4; tumor necrosis factor ligand 2B; tumor necrosis factor superfamily member 4 |
Gene ID | 7292 |
mRNA Refseq | NM_003326 |
Protein Refseq | NP_003317 |
MIM | 603594 |
UniProt ID | P23510 |
◆ Recombinant Proteins | ||
TNFSF4-490HAF647 | Recombinant Human TNFSF4 Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFSF4-086H | Recombinant Human TNFSF4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tnfsf4-407M | Active Recombinant Mouse Tnfsf4, FLAG-tagged | +Inquiry |
RFL34357HF | Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 4(Tnfsf4) Protein, His-Tagged | +Inquiry |
TNFSF4-690M | Recombinant Mouse TNFSF4 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF4-857CCL | Recombinant Cynomolgus TNFSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF4 Products
Required fields are marked with *
My Review for All TNFSF4 Products
Required fields are marked with *