Recombinant Human TNFSF4 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : TNFSF4-086H
Product Overview : TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
Molecular Mass : 20.9 kDa
AA Sequence : MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TNFSF4 TNF superfamily member 4 [ Homo sapiens (human) ]
Official Symbol TNFSF4
Synonyms TNFSF4; TNF superfamily member 4; CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1; tumor necrosis factor ligand superfamily member 4; CD134 ligand; OX40 antigen ligand; glycoprotein Gp34; tax-transcriptionally activated glycoprotein 1 (34kD); tumor necrosis factor (ligand) superfamily member 4; tumor necrosis factor ligand 2B; tumor necrosis factor superfamily member 4
Gene ID 7292
mRNA Refseq NM_003326
Protein Refseq NP_003317
MIM 603594
UniProt ID P23510

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF4 Products

Required fields are marked with *

My Review for All TNFSF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon