Recombinant Human TNFSF8 Protein, C-His-tagged
| Cat.No. : | TNFSF8-189H |
| Product Overview : | Recombinant Human TNFSF8 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. |
| Molecular Mass : | ~19 kDa |
| AA Sequence : | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens (human) ] |
| Official Symbol | TNFSF8 |
| Synonyms | TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144; |
| Gene ID | 944 |
| mRNA Refseq | NM_001244 |
| Protein Refseq | NP_001235 |
| MIM | 603875 |
| UniProt ID | P32971 |
| ◆ Recombinant Proteins | ||
| TNFSF8-15H | Recombinant Human TNFSF8 Protein (N165A), His-tagged | +Inquiry |
| TNFSF8-23H | Recombinant Human TNFSF8 Protein (K78A), His-tagged | +Inquiry |
| TNFSF8-015H | Recombinant Human TNFSF8 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TNFSF8-381R | Recombinant Rat Tnfsf8, Gly & Pro tagged | +Inquiry |
| TNFSF8-890H | Active Recombinant Human TNFSF8 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
| TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
| TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF8 Products
Required fields are marked with *
My Review for All TNFSF8 Products
Required fields are marked with *
