Recombinant Human TNFSF8 Protein, C-His-tagged
Cat.No. : | TNFSF8-189H |
Product Overview : | Recombinant Human TNFSF8 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. |
Molecular Mass : | ~19 kDa |
AA Sequence : | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens (human) ] |
Official Symbol | TNFSF8 |
Synonyms | TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144; |
Gene ID | 944 |
mRNA Refseq | NM_001244 |
Protein Refseq | NP_001235 |
MIM | 603875 |
UniProt ID | P32971 |
◆ Recombinant Proteins | ||
TNFSF8-829H | Recombinant Human TNFSF8 protein, His-tagged, low endotoxin | +Inquiry |
TNFSF8-22H | Recombinant Human TNFSF8 Protein (S83A), His-tagged | +Inquiry |
TNFSF8-21H | Recombinant Human TNFSF8 Protein (K166A+I168A+K169A), His-tagged | +Inquiry |
TNFSF8-9487M | Recombinant Mouse TNFSF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF8-182H | Recombinant Human TNFSF8 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF8 Products
Required fields are marked with *
My Review for All TNFSF8 Products
Required fields are marked with *
0
Inquiry Basket