Recombinant Human TNFSF8 protein, His-tagged
| Cat.No. : | TNFSF8-3577H |
| Product Overview : | Recombinant Human TNFSF8 protein(61-234 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 61-234 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ] |
| Official Symbol | TNFSF8 |
| Synonyms | TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144; |
| Gene ID | 944 |
| mRNA Refseq | NM_001244 |
| Protein Refseq | NP_001235 |
| MIM | 603875 |
| UniProt ID | P32971 |
| ◆ Recombinant Proteins | ||
| TNFSF8-14H | Recombinant Human TNFSF8 Protein (K169A), His-tagged | +Inquiry |
| TNFSF8-0907H | Recombinant Human TNFSF8 Protein (Leu60-Ile227), N-His tagged | +Inquiry |
| TNFSF8-3577H | Recombinant Human TNFSF8 protein, His-tagged | +Inquiry |
| TNFSF8-5632H | Recombinant Human TNFSF8 protein, mFc-tagged | +Inquiry |
| TNFSF8-248H | Recombinant Human TNFSF8, StrepII-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
| TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
| TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF8 Products
Required fields are marked with *
My Review for All TNFSF8 Products
Required fields are marked with *
