Recombinant Human TNFSF8 protein, His-tagged
Cat.No. : | TNFSF8-3577H |
Product Overview : | Recombinant Human TNFSF8 protein(61-234 aa), fused to His tag, was expressed in E. coli. |
Availability | September 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 61-234 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ] |
Official Symbol | TNFSF8 |
Synonyms | TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144; |
Gene ID | 944 |
mRNA Refseq | NM_001244 |
Protein Refseq | NP_001235 |
MIM | 603875 |
UniProt ID | P32971 |
◆ Recombinant Proteins | ||
TNFSF8-14H | Recombinant Human TNFSF8 Protein (K169A), His-tagged | +Inquiry |
TNFSF8-5632H | Recombinant Human TNFSF8 protein, mFc-tagged | +Inquiry |
TNFSF8-326H | Recombinant Human TNFSF8 Protein (Gln63-Asp234), Gly & Pro | +Inquiry |
TNFSF8-9487M | Recombinant Mouse TNFSF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tnfsf8-1714M | Recombinant Mouse Tnfsf8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF8 Products
Required fields are marked with *
My Review for All TNFSF8 Products
Required fields are marked with *