Recombinant Human TNIP3 protein, GST-tagged
| Cat.No. : | TNIP3-301379H |
| Product Overview : | Recombinant Human TNIP3 protein(236-325 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 236-325 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | QSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPWVPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | TNIP3 |
| Synonyms | TNIP3; TNFAIP3 interacting protein 3; TNFAIP3-interacting protein 3; ABIN 3; FLJ21162; LIND; TNIP3 beta; ABIN-3 beta; Listeria induced; listeria-induced gene protein; TNFAIP3-interacting protein 3 beta; A20-binding inhibitor of NF-kappa-B activation 3; ABIN-3; |
| Gene ID | 79931 |
| mRNA Refseq | NM_001128843 |
| Protein Refseq | NP_001122315 |
| MIM | 608019 |
| UniProt ID | Q96KP6 |
| ◆ Recombinant Proteins | ||
| TNIP3-301379H | Recombinant Human TNIP3 protein, GST-tagged | +Inquiry |
| Tnip3-6562M | Recombinant Mouse Tnip3 Protein, Myc/DDK-tagged | +Inquiry |
| TNIP3-2071H | Recombinant Human TNIP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TNIP3-3073H | Recombinant Human TNIP3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNIP3-887HCL | Recombinant Human TNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNIP3 Products
Required fields are marked with *
My Review for All TNIP3 Products
Required fields are marked with *
