Recombinant Human TNIP3 protein, His-tagged
Cat.No. : | TNIP3-3073H |
Product Overview : | Recombinant Human TNIP3 protein(236-325 aa), fused to His tag, was expressed in E. coli. |
Availability | August 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 236-325 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPWVPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TNIP3 TNFAIP3 interacting protein 3 [ Homo sapiens ] |
Official Symbol | TNIP3 |
Synonyms | TNIP3; TNFAIP3 interacting protein 3; TNFAIP3-interacting protein 3; ABIN 3; FLJ21162; LIND; TNIP3 beta; ABIN-3 beta; Listeria induced; listeria-induced gene protein; TNFAIP3-interacting protein 3 beta; A20-binding inhibitor of NF-kappa-B activation 3; ABIN-3; |
Gene ID | 79931 |
mRNA Refseq | NM_001128843 |
Protein Refseq | NP_001122315 |
MIM | 608019 |
UniProt ID | Q96KP6 |
◆ Recombinant Proteins | ||
TNIP3-3073H | Recombinant Human TNIP3 protein, His-tagged | +Inquiry |
TNIP3-2071H | Recombinant Human TNIP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tnip3-6562M | Recombinant Mouse Tnip3 Protein, Myc/DDK-tagged | +Inquiry |
TNIP3-301379H | Recombinant Human TNIP3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNIP3-887HCL | Recombinant Human TNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNIP3 Products
Required fields are marked with *
My Review for All TNIP3 Products
Required fields are marked with *