Recombinant Human TNNI2, GST-tagged
Cat.No. : | TNNI2-17H |
Product Overview : | Recombinant Human TNNI2(1 a.a. - 182 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 47.7 kDa |
AA Sequence : | MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAA EEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTE KERDLRDVGDWRKNIEEKSGMEGRKKMFESES |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TNNI2 troponin I type 2 (skeletal, fast) [ Homo sapiens (human) ] |
Official Symbol | TNNI2 |
Synonyms | TNNI2; troponin I type 2 (skeletal, fast); troponin I, skeletal, fast; troponin I, fast skeletal muscle; AMCD2B; DA2B; FSSV; troponin I fast twitch 2; troponin I; fast twitch skeletal muscle isoform |
Gene ID | 7136 |
mRNA Refseq | NM_003282 |
Protein Refseq | NP_003273 |
MIM | 191043 |
UniProt ID | P48788 |
Chromosome Location | 11p15.5 |
Pathway | Muscle contraction; Striated Muscle Contraction |
Function | contributes_to actin binding; protein binding; troponin T binding |
◆ Recombinant Proteins | ||
TNNI2-7823HFL | Recombinant Full Length Human TNNI2, Flag-tagged | +Inquiry |
Tnni2-3606M | Recombinant Mouse Tnni2 protein, His&Myc-tagged | +Inquiry |
TNNI2-371H | Recombinant Human troponin I type 2 (skeletal, fast), His-tagged | +Inquiry |
TNNI2-4784C | Recombinant Chicken TNNI2 protein, Avi-tagged, Biotinylated | +Inquiry |
TNNI2-6968C | Recombinant Chicken TNNI2 | +Inquiry |
◆ Native Proteins | ||
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNI2-1802HCL | Recombinant Human TNNI2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNNI2 Products
Required fields are marked with *
My Review for All TNNI2 Products
Required fields are marked with *