Recombinant Human TNPO1

Cat.No. : TNPO1-31605TH
Product Overview : Recombinant fragment of Human Transportin 1 with a N terminal proprietary tag: predicted molecular weight 38.50 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 117 amino acids
Description : This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in two transcript variants encoding different proteins.
Molecular Weight : 38.500kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPT RSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSP LIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED*
Gene Name TNPO1 transportin 1 [ Homo sapiens ]
Official Symbol TNPO1
Synonyms TNPO1; transportin 1; karyopherin (importin) beta 2 , KPNB2; transportin-1; importin 2; IPO2; MIP; MIP1; TRN;
Gene ID 3842
mRNA Refseq NM_002270
Protein Refseq NP_002261
MIM 602901
Uniprot ID Q92973
Chromosome Location 5q13.1
Pathway Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem;
Function nuclear localization sequence binding; protein binding; protein transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNPO1 Products

Required fields are marked with *

My Review for All TNPO1 Products

Required fields are marked with *

0
cart-icon
0
compare icon