Recombinant Human TNPO1

• Cat.No.: TNPO1-31605TH
• Product Overview: Recombinant fragment of Human Transportin 1 with a N terminal proprietary tag: predicted molecular weight 38.50 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 117 amino acids
• Description: This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in two transcript variants encoding different proteins.
• Molecular Weight: 38.500kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPT RSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSP LIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED*

Gene Information

• Gene Name: TNPO1 transportin 1 [ Homo sapiens ]
• Official Symbol: TNPO1
• Synonyms: TNPO1; transportin 1; karyopherin (importin) beta 2 , KPNB2; transportin-1; importin 2; IPO2; MIP; MIP1; TRN
• Gene ID: 3842
• mRNA Refseq: NM_002270
• Protein Refseq: NP_002261
• MIM: 602901
• Uniprot ID: Q92973
• Chromosome Location: 5q13.1
• Pathway: Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem
• Function: nuclear localization sequence binding; protein binding; protein transporter activity