Recombinant Human TOMM6 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TOMM6-4737H |
| Product Overview : | TOMM6 MS Standard C13 and N15-labeled recombinant protein (NP_001127965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TOMM6 (Translocase Of Outer Mitochondrial Membrane 6) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Mitophagy. |
| Molecular Mass : | 7.8 kDa |
| AA Sequence : | MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TOMM6 translocase of outer mitochondrial membrane 6 [ Homo sapiens (human) ] |
| Official Symbol | TOMM6 |
| Synonyms | TOMM6; translocase of outer mitochondrial membrane 6; OBTP; TOM6; mitochondrial import receptor subunit TOM6 homolog; over-expressed breast tumor protein; overexpressed breast tumor protein; translocase of outer membrane 6 kDa subunit homolog; translocase of outer mitochondrial membrane 6 homolog |
| Gene ID | 100188893 |
| mRNA Refseq | NM_001134493 |
| Protein Refseq | NP_001127965 |
| MIM | 616168 |
| UniProt ID | Q96B49 |
| ◆ Recombinant Proteins | ||
| TOMM6-4710R | Recombinant Rhesus Macaque TOMM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tomm6-1353M | Recombinant Mouse Tomm6 Protein, Myc/DDK-tagged | +Inquiry |
| TOMM6-4896R | Recombinant Rhesus monkey TOMM6 Protein, His-tagged | +Inquiry |
| TOMM6-9513M | Recombinant Mouse TOMM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TOMM6-3349H | Recombinant Human TOMM6, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TOMM6-698HCL | Recombinant Human TOMM6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOMM6 Products
Required fields are marked with *
My Review for All TOMM6 Products
Required fields are marked with *
