Recombinant Human TOMM6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TOMM6-4737H
Product Overview : TOMM6 MS Standard C13 and N15-labeled recombinant protein (NP_001127965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TOMM6 (Translocase Of Outer Mitochondrial Membrane 6) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Mitophagy.
Molecular Mass : 7.8 kDa
AA Sequence : MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TOMM6 translocase of outer mitochondrial membrane 6 [ Homo sapiens (human) ]
Official Symbol TOMM6
Synonyms TOMM6; translocase of outer mitochondrial membrane 6; OBTP; TOM6; mitochondrial import receptor subunit TOM6 homolog; over-expressed breast tumor protein; overexpressed breast tumor protein; translocase of outer membrane 6 kDa subunit homolog; translocase of outer mitochondrial membrane 6 homolog
Gene ID 100188893
mRNA Refseq NM_001134493
Protein Refseq NP_001127965
MIM 616168
UniProt ID Q96B49

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOMM6 Products

Required fields are marked with *

My Review for All TOMM6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon