Recombinant Human TOMM6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TOMM6-4737H |
Product Overview : | TOMM6 MS Standard C13 and N15-labeled recombinant protein (NP_001127965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TOMM6 (Translocase Of Outer Mitochondrial Membrane 6) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Mitophagy. |
Molecular Mass : | 7.8 kDa |
AA Sequence : | MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TOMM6 translocase of outer mitochondrial membrane 6 [ Homo sapiens (human) ] |
Official Symbol | TOMM6 |
Synonyms | TOMM6; translocase of outer mitochondrial membrane 6; OBTP; TOM6; mitochondrial import receptor subunit TOM6 homolog; over-expressed breast tumor protein; overexpressed breast tumor protein; translocase of outer membrane 6 kDa subunit homolog; translocase of outer mitochondrial membrane 6 homolog |
Gene ID | 100188893 |
mRNA Refseq | NM_001134493 |
Protein Refseq | NP_001127965 |
MIM | 616168 |
UniProt ID | Q96B49 |
◆ Recombinant Proteins | ||
TOMM6-9513M | Recombinant Mouse TOMM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOMM6-3349H | Recombinant Human TOMM6, GST-tagged | +Inquiry |
TOMM6-5617C | Recombinant Chicken TOMM6 | +Inquiry |
TOMM6-4737H | Recombinant Human TOMM6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TOMM6-4710R | Recombinant Rhesus Macaque TOMM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOMM6-698HCL | Recombinant Human TOMM6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOMM6 Products
Required fields are marked with *
My Review for All TOMM6 Products
Required fields are marked with *
0
Inquiry Basket