Recombinant Human TOP2B, His-tagged
Cat.No. : | TOP2B-19H |
Product Overview : | Recombinant hTOP2βcore (residues 445-1201), fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques. Theoretical pI: 6.5 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 445-1201 a.a. |
Description : | This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, beta, is localized to chromosome 3 and the alpha form is localized to chromosome 17. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. Alternative splicing of this gene results in two transcript variants; however, the second variant has not yet been fully described. |
Form : | Liquid. 20 mM Tris-HCl, 200 mM NaCl, pH7.4. |
Molecular Mass : | ~87 kDa |
AA Sequence : | SVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIME NAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIV KASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAF SKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRK VLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASP RYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRR MLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPAL ISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLS YYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDET QNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKV ESQERED |
Purity : | > 92% as determined by SDS-PAGE |
Storage : | Short Term Storage at +4°C, Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles. |
Gene Name | TOP2B topoisomerase (DNA) II beta 180kDa [ Homo sapiens (human) ] |
Official Symbol | TOP2B |
Synonyms | TOPIIB; top2beta; TOP2B; DNA topoisomerase II, beta isozyme; topo II beta; antigen MLAA-44; topoisomerase IIb; topoisomerase II beta; U937 associated antigen; DNA topoisomerase II beta; DNA topoisomerase II, 180 Kd; EC 5.99.1.3; DNA topoisomerase 2-beta |
Gene ID | 7155 |
mRNA Refseq | NM_001068 |
Protein Refseq | NP_001059 |
MIM | 126431 |
UniProt ID | Q02880 |
Chromosome Location | 3p24 |
Function | ATP binding; DNA topoisomerase (ATP-hydrolyzing) activity; chromatin binding; histone deacetylase binding; nucleotide binding; protein C-terminus binding; protein heterodimerization activity; protein kinase C binding |
◆ Recombinant Proteins | ||
TOP2B-4714R | Recombinant Rhesus Macaque TOP2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Top2b-8246M | Recombinant Mouse Top2b protein, His & T7-tagged | +Inquiry |
TOP2B-4900R | Recombinant Rhesus monkey TOP2B Protein, His-tagged | +Inquiry |
TOP2B-6639C | Recombinant Chicken TOP2B | +Inquiry |
TOP2B-19H | Recombinant Human TOP2B, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOP2B Products
Required fields are marked with *
My Review for All TOP2B Products
Required fields are marked with *
0
Inquiry Basket