Recombinant Human TOR1AIP1 protein, His-tagged
Cat.No. : | TOR1AIP1-6744H |
Product Overview : | Recombinant Human TOR1AIP1 protein(1-218 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-218 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MKTRRTTRLQQQHSEQPPLQPSPVTTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQRSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWW |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TOR1AIP1 torsin A interacting protein 1 [ Homo sapiens ] |
Official Symbol | TOR1AIP1 |
Synonyms | TOR1AIP1; torsin A interacting protein 1; torsin-1A-interacting protein 1; FLJ13142; lamina associated polypeptide 1B; LAP1B; lamin-associated protein 1B; lamina-associated polypeptide 1B; LAP1; MGC3413; RP11-533E19.1; DKFZp586G011; |
Gene ID | 26092 |
mRNA Refseq | NM_015602 |
Protein Refseq | NP_056417 |
MIM | 614512 |
UniProt ID | Q5JTV8 |
◆ Recombinant Proteins | ||
TOR1AIP1-5883R | Recombinant Rat TOR1AIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL15344RF | Recombinant Full Length Rat Torsin-1A-Interacting Protein 1(Tor1Aip1) Protein, His-Tagged | +Inquiry |
TOR1AIP1-17237M | Recombinant Mouse TOR1AIP1 Protein | +Inquiry |
RFL25048MF | Recombinant Full Length Mouse Torsin-1A-Interacting Protein 1(Tor1Aip1) Protein, His-Tagged | +Inquiry |
TOR1AIP1-6226R | Recombinant Rat TOR1AIP1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOR1AIP1 Products
Required fields are marked with *
My Review for All TOR1AIP1 Products
Required fields are marked with *