Recombinant Human TOR1AIP1 protein, His-tagged

• Cat.No.: TOR1AIP1-6744H
• Product Overview: Recombinant Human TOR1AIP1 protein(1-218 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-218 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MKTRRTTRLQQQHSEQPPLQPSPVTTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQRSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWW
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TOR1AIP1 torsin A interacting protein 1 [ Homo sapiens ]
• Official Symbol: TOR1AIP1
• Synonyms: TOR1AIP1; torsin A interacting protein 1; torsin-1A-interacting protein 1; FLJ13142; lamina associated polypeptide 1B; LAP1B; lamin-associated protein 1B; lamina-associated polypeptide 1B; LAP1; MGC3413; RP11-533E19.1; DKFZp586G011
• Gene ID: 26092
• mRNA Refseq: NM_015602
• Protein Refseq: NP_056417
• MIM: 614512
• UniProt ID: Q5JTV8