Recombinant Human TP53
Cat.No. : | TP53-31456TH |
Product Overview : | Recombinant fragment: MEEPQSDPSV EPPLSQETFS DQSKLLPENN VLSPLPSQAM DDLMLSPDDI EQWFTEDPGP DEAPRMPEAA PRVAPAPAAP T, corresponding to amino acids 1-81 of Human p53 with two point mutations L22Q and W23S and proprietary tag, predicted MWt 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-81 a.a. |
Description : | This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where its believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity. |
Tissue specificity : | Ubiquitous. Isoforms are expressed in a wide range of normal tissues but in a tissue-dependent manner. Isoform 2 is expressed in most normal tissues but is not detected in brain, lung, prostate, muscle, fetal brain, spinal cord and fetal liver. Isoform 3 |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Potassium chloride, 1mM DTT, 0.2mM EDTA, pH 8.0 |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEEPQSDPSVEPPLSQETFSDQSKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPT |
Sequence Similarities : | Belongs to the p53 family. |
Gene Name | TP53 tumor protein p53 [ Homo sapiens ] |
Official Symbol | TP53 |
Synonyms | TP53; tumor protein p53; cellular tumor antigen p53; LFS1; Li Fraumeni syndrome; p53; |
Gene ID | 7157 |
mRNA Refseq | NM_000546 |
Protein Refseq | NP_000537 |
MIM | 191170 |
Uniprot ID | P04637 |
Chromosome Location | 17p13.1 |
Pathway | Activation of BH3-only proteins, organism-specific biosystem; Activation of NOXA and translocation to mitochondria, organism-specific biosystem; Activation of PUMA and translocation to mitochondria, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
Function | ATP binding; DNA binding; DNA strand annealing activity; MDM2 binding; RNA polymerase II transcription factor binding; |
◆ Recombinant Proteins | ||
TP53-30570TH | Recombinant Human TP53, His-tagged | +Inquiry |
TP53-3445H | Active Recombinant Human TP53, His-tagged | +Inquiry |
TP53-5633H | Recombinant Human TP53 protein, His-tagged | +Inquiry |
TP53-4724R | Recombinant Rhesus Macaque TP53 Protein, His (Fc)-Avi-tagged | +Inquiry |
TP53-6496H | Recombinant Human TP53 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TP53-01HFL | Active Recombinant Full Length Human TP53 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *
0
Inquiry Basket