Recombinant Human TP53 Protein, His-tagged
Cat.No. : | TP53-6496H |
Product Overview : | Recombinant Human TP53 protein(Asp7-Asp393), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Asp7-Asp393 |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose. |
Molecular Mass : | The protein has a calculated MW of 45 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.6 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD |
Gene Name | TP53 tumor protein p53 [ Homo sapiens ] |
Official Symbol | TP53 |
Synonyms | TP53; tumor protein p53; cellular tumor antigen p53; LFS1; Li Fraumeni syndrome; p53; antigen NY-CO-13; mutant p53 protein; phosphoprotein p53; p53 tumor suppressor; truncated p53 protein; tumor suppressor TP53; transformation-related protein 53; P53; TRP53; FLJ92943; |
Gene ID | 7157 |
mRNA Refseq | NM_000546 |
Protein Refseq | NP_000537 |
MIM | 191170 |
UniProt ID | P04637 |
◆ Recombinant Proteins | ||
TP53-1044C | Recombinant Cynomolgus TP53 Protein, His-tagged | +Inquiry |
TP53-1077H | Active Recombinant Human Tumor Protein P53, GST-tagged | +Inquiry |
TP53-4922H | Recombinant Human TP53 protein(1-393aa(R273H)), His-tagged | +Inquiry |
TP53-8275Z | Recombinant Zebrafish TP53 | +Inquiry |
TP53-2548H | Recombinant Human TP53 protein(101-310 aa), N-MBP & C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *
0
Inquiry Basket