Recombinant Human TP53 Protein, His-tagged

• Cat.No.: TP53-6496H
• Product Overview: Recombinant Human TP53 protein(Asp7-Asp393), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Asp7-Asp393
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose.
• Molecular Mass: The protein has a calculated MW of 45 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.6 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

Gene Information

• Gene Name: TP53 tumor protein p53 [ Homo sapiens ]
• Official Symbol: TP53
• Synonyms: TP53; tumor protein p53; cellular tumor antigen p53; LFS1; Li Fraumeni syndrome; p53; antigen NY-CO-13; mutant p53 protein; phosphoprotein p53; p53 tumor suppressor; truncated p53 protein; tumor suppressor TP53; transformation-related protein 53; P53; TRP53; FLJ92943
• Gene ID: 7157
• mRNA Refseq: NM_000546
• Protein Refseq: NP_000537
• MIM: 191170
• UniProt ID: P04637