Recombinant Human TPM3
Cat.No. : | TPM3-28H |
Product Overview : | Recombinant Human Tropomyosin Alpha-3 Chain/TPM3 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Met248) of Human TPM3. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-248 a.a. |
Description : | This gene encodes a member of the tropomyosin family of actin-binding proteins. Tropomyosins are dimers of coiled-coil proteins that provide stability to actin filaments and regulate access of other actin-binding proteins. Mutations in this gene result in autosomal dominant nemaline myopathy and other muscle disorders. This locus is involved in translocations with other loci, including anaplastic lymphoma receptor tyrosine kinase (ALK) and neurotrophic tyrosine kinase receptor type 1 (NTRK1), which result in the formation of fusion proteins that act as oncogenes. There are numerous pseudogenes for this gene on different chromosomes. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
AA Sequence : | MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDR AQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVA RKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDK LKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TPM3 tropomyosin 3 [ Homo sapiens (human) ] |
Official Symbol | TPM3 |
Synonyms | TPM3; tropomyosin 3; NEM1; tropomyosin alpha-3 chain; TRK; tropomyosin-3; tropomyosin-5; gamma-tropomyosin; tropomyosin gamma; cytoskeletal tropomyosin TM30; heat-stable cytoskeletal protein 30 kDa; TM3; TM5; CFTD; TM-5; TM30; hTM5; TM30nm; TPMsk3; hscp30; OK/SW-cl.5; MGC3261; FLJ41118; MGC14582; MGC72094 |
Gene ID | 7170 |
mRNA Refseq | NM_001043351 |
Protein Refseq | NP_001036816 |
MIM | 191030 |
UniProt ID | P06753 |
Chromosome Location | 1q21.2 |
Pathway | Adrenergic signaling in cardiomyocytes; Cardiac muscle contraction; Hypertrophic cardiomyopathy (HCM); Smooth Muscle Contraction |
Function | actin binding; molecular_function |
◆ Recombinant Proteins | ||
TPM3-1380H | Recombinant Human TPM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tpm3-471R | Recombinant Rat Tpm3 Protein, His-tagged | +Inquiry |
Tpm3-6600M | Recombinant Mouse Tpm3 Protein, Myc/DDK-tagged | +Inquiry |
TPM3-5900R | Recombinant Rat TPM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tpm3-8048M | Recombinant Mouse Tpm3 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPM3-842HCL | Recombinant Human TPM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPM3 Products
Required fields are marked with *
My Review for All TPM3 Products
Required fields are marked with *
0
Inquiry Basket