Recombinant Human TPPP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TPPP3-6187H
Product Overview : TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057224) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TPPP3 (Tubulin Polymerization Promoting Protein Family Member 3) is a Protein Coding gene. Diseases associated with TPPP3 include Cerebrospinal Fluid Leak and Creutzfeldt-Jakob Disease. Gene Ontology (GO) annotations related to this gene include tubulin binding. An important paralog of this gene is TPPP.
Molecular Mass : 19 kDa
AA Sequence : MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TPPP3 tubulin polymerization-promoting protein family member 3 [Homo sapiens (human) ]
Official Symbol TPPP3
Synonyms TPPP3; p20; CGI-38; p25gamma; tubulin polymerization-promoting protein family member 3; TPPP/p20; brain specific protein
Gene ID 51673
mRNA Refseq NM_016140
Protein Refseq NP_057224
MIM 616957
UniProt ID Q9BW30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPPP3 Products

Required fields are marked with *

My Review for All TPPP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon