Recombinant Human TPPP3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TPPP3-6187H |
Product Overview : | TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057224) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TPPP3 (Tubulin Polymerization Promoting Protein Family Member 3) is a Protein Coding gene. Diseases associated with TPPP3 include Cerebrospinal Fluid Leak and Creutzfeldt-Jakob Disease. Gene Ontology (GO) annotations related to this gene include tubulin binding. An important paralog of this gene is TPPP. |
Molecular Mass : | 19 kDa |
AA Sequence : | MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TPPP3 tubulin polymerization-promoting protein family member 3 [Homo sapiens (human) ] |
Official Symbol | TPPP3 |
Synonyms | TPPP3; p20; CGI-38; p25gamma; tubulin polymerization-promoting protein family member 3; TPPP/p20; brain specific protein |
Gene ID | 51673 |
mRNA Refseq | NM_016140 |
Protein Refseq | NP_057224 |
MIM | 616957 |
UniProt ID | Q9BW30 |
◆ Recombinant Proteins | ||
Tppp3-6607M | Recombinant Mouse Tppp3 Protein, Myc/DDK-tagged | +Inquiry |
TPPP3-6187H | Recombinant Human TPPP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPPP3-4736R | Recombinant Rhesus Macaque TPPP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPPP3-560H | Recombinant Human TPPP3 protein, His-tagged | +Inquiry |
TPPP3-2244H | Recombinant Human TPPP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPPP3-343HCL | Recombinant Human TPPP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPPP3 Products
Required fields are marked with *
My Review for All TPPP3 Products
Required fields are marked with *