Recombinant Human TPRKB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TPRKB-4205H |
Product Overview : | TPRKB MS Standard C13 and N15-labeled recombinant protein (NP_057142) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TPRKB acts as an allosteric effector that regulates the t(6)A activity of the complex. TPRKB is not required for tRNA modification. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TPRKB TP53RK binding protein [ Homo sapiens (human) ] |
Official Symbol | TPRKB |
Synonyms | TPRKB; TP53RK binding protein; TP53RK-binding protein; CGI 121; PRPK-binding protein; PRPK (p53-related protein kinase)-binding protein; CGI-121; |
Gene ID | 51002 |
mRNA Refseq | NM_016058 |
Protein Refseq | NP_057142 |
MIM | 608680 |
UniProt ID | Q9Y3C4 |
◆ Recombinant Proteins | ||
TPRKB-4205H | Recombinant Human TPRKB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPRKB-1333H | Recombinant Human TPRKB Protein, GST-Tagged | +Inquiry |
TPRKB-1760Z | Recombinant Zebrafish TPRKB | +Inquiry |
Tprkb-6610M | Recombinant Mouse Tprkb Protein, Myc/DDK-tagged | +Inquiry |
TPRKB-3377H | Recombinant Human TPRKB, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPRKB-836HCL | Recombinant Human TPRKB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPRKB Products
Required fields are marked with *
My Review for All TPRKB Products
Required fields are marked with *
0
Inquiry Basket