Recombinant Human TPRKB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TPRKB-4205H
• Product Overview: TPRKB MS Standard C13 and N15-labeled recombinant protein (NP_057142) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TPRKB acts as an allosteric effector that regulates the t(6)A activity of the complex. TPRKB is not required for tRNA modification.
• Molecular Mass: 19.7 kDa
• AA Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TPRKB TP53RK binding protein [ Homo sapiens (human) ]
• Official Symbol: TPRKB
• Synonyms: TPRKB; TP53RK binding protein; TP53RK-binding protein; CGI 121; PRPK-binding protein; PRPK (p53-related protein kinase)-binding protein; CGI-121
• Gene ID: 51002
• mRNA Refseq: NM_016058
• Protein Refseq: NP_057142
• MIM: 608680
• UniProt ID: Q9Y3C4