Recombinant Human TPSB2 Protein, His-tagged

Cat.No. : TPSB2-418H
Product Overview : Recombinant Human TPSB2 fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders.
Form : Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0
Molecular Mass : 29.64kD
AA Sequence : APAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name TPSB2 tryptase beta 2 (gene/pseudogene) [ Homo sapiens ]
Official Symbol TPSB2
Synonyms TPSB2; tryptase beta 2 (gene/pseudogene); tryptase beta 2; tryptase beta-2; tryptase beta II; tryptase beta III; tryptase-2; tryptase II; tryptase III; mast cell tryptase beta II; mast cell tryptase beta III; TPS2; tryptaseB; tryptaseC;
Gene ID 64499
mRNA Refseq NM_024164
Protein Refseq NP_077078
MIM 191081
UniProt ID P20231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPSB2 Products

Required fields are marked with *

My Review for All TPSB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon