Recombinant Human TPTE protein, GST-tagged
| Cat.No. : | TPTE-3382H |
| Product Overview : | Recombinant Human TPTE protein(209-533 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 209-533 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | KRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICSTAKESLYYFGERRTDKTHSEKFQGVETPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TPTE transmembrane phosphatase with tensin homology [ Homo sapiens ] |
| Official Symbol | TPTE |
| Synonyms | TPTE; transmembrane phosphatase with tensin homology; putative tyrosine-protein phosphatase TPTE; cancer/testis antigen 44; CT44; PTEN related tyrosine phosphatase; PTEN2; tumor antigen BJ-HCC-5; PTEN-related tyrosine phosphatase; tensin, putative protein-tyrosine phosphatase; |
| Gene ID | 7179 |
| mRNA Refseq | NM_199259 |
| Protein Refseq | NP_954868 |
| MIM | 604336 |
| UniProt ID | P56180 |
| ◆ Recombinant Proteins | ||
| TPTE-2791H | Recombinant Human TPTE protein(11-80 aa), C-His-tagged | +Inquiry |
| TPTE-3101Z | Recombinant Zebrafish TPTE | +Inquiry |
| TPTE-3382H | Recombinant Human TPTE protein, GST-tagged | +Inquiry |
| TPTE-5374H | Recombinant Human TPTE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL421HF | Recombinant Full Length Human Putative Tyrosine-Protein Phosphatase Tpte(Tpte) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPTE-830HCL | Recombinant Human TPTE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPTE Products
Required fields are marked with *
My Review for All TPTE Products
Required fields are marked with *
