Recombinant Human TPTE protein(11-80 aa), C-His-tagged
Cat.No. : | TPTE-2791H |
Product Overview : | Recombinant Human TPTE protein(P56180)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-80 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVLARLSKFEVEDAENVASYDSK |
Gene Name | TPTE transmembrane phosphatase with tensin homology [ Homo sapiens ] |
Official Symbol | TPTE |
Synonyms | TPTE; transmembrane phosphatase with tensin homology; putative tyrosine-protein phosphatase TPTE; cancer/testis antigen 44; CT44; PTEN related tyrosine phosphatase; PTEN2; tumor antigen BJ-HCC-5; PTEN-related tyrosine phosphatase; tensin, putative protein-tyrosine phosphatase; |
Gene ID | 7179 |
mRNA Refseq | NM_199259 |
Protein Refseq | NP_954868 |
MIM | 604336 |
UniProt ID | P56180 |
◆ Recombinant Proteins | ||
TPTE-3382H | Recombinant Human TPTE protein, GST-tagged | +Inquiry |
TPTE-3101Z | Recombinant Zebrafish TPTE | +Inquiry |
TPTE-2791H | Recombinant Human TPTE protein(11-80 aa), C-His-tagged | +Inquiry |
RFL421HF | Recombinant Full Length Human Putative Tyrosine-Protein Phosphatase Tpte(Tpte) Protein, His-Tagged | +Inquiry |
TPTE-5374H | Recombinant Human TPTE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPTE-830HCL | Recombinant Human TPTE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPTE Products
Required fields are marked with *
My Review for All TPTE Products
Required fields are marked with *