Recombinant Human TRAF1 protein, His-tagged
Cat.No. : | TRAF1-2848H |
Product Overview : | Recombinant Human TRAF1 protein(173-295 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 173-295 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | QEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPA |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TRAF1 TNF receptor-associated factor 1 [ Homo sapiens ] |
Official Symbol | TRAF1 |
Synonyms | TRAF1; TNF receptor-associated factor 1; EBI6; Epstein-Bar virus-induced protein 6; MGC:10353; |
mRNA Refseq | NM_001190945 |
Protein Refseq | NP_001177874 |
MIM | 601711 |
UniProt ID | Q13077 |
Gene ID | 7185 |
◆ Recombinant Proteins | ||
TRAF1-6882Z | Recombinant Zebrafish TRAF1 | +Inquiry |
TRAF1-389H | Recombinant Human TRAF1 Protein, His/GST-tagged | +Inquiry |
TRAF1-4930R | Recombinant Rhesus monkey TRAF1 Protein, His-tagged | +Inquiry |
TRAF1-29978TH | Recombinant Human TRAF1, His-tagged | +Inquiry |
TRAF1-2806H | Recombinant Human TRAF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAF1-825HCL | Recombinant Human TRAF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAF1 Products
Required fields are marked with *
My Review for All TRAF1 Products
Required fields are marked with *
0
Inquiry Basket