Recombinant Human TRAF3IP2 protein, His-tagged
| Cat.No. : | TRAF3IP2-2918H |
| Product Overview : | Recombinant Human TRAF3IP2 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-350 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TRAF3IP2 TRAF3 interacting protein 2 [ Homo sapiens ] |
| Official Symbol | TRAF3IP2 |
| Synonyms | TRAF3IP2; TRAF3 interacting protein 2; C6orf2, C6orf4, C6orf5, C6orf6, chromosome 6 open reading frame 2 , chromosome 6 open reading frame 5; adapter protein CIKS; ACT1; CIKS; DKFZP586G0522; NFkB-activating protein ACT1; connection to IKK and SAPK/JNK; nuclear factor NF-kappa-B activator 1; C6orf2; C6orf4; C6orf5; C6orf6; PSORS13; MGC3581; DKFZp586G0522; |
| Gene ID | 10758 |
| mRNA Refseq | NM_001164281 |
| Protein Refseq | NP_001157753 |
| MIM | 607043 |
| UniProt ID | O43734 |
| ◆ Recombinant Proteins | ||
| TRAF3IP2-4746R | Recombinant Rhesus Macaque TRAF3IP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRAF3IP2-3150H | Recombinant Human TRAF3IP2, His-tagged | +Inquiry |
| TRAF3IP2-1335H | Recombinant Human TRAF3IP2 Protein, GST-Tagged | +Inquiry |
| TRAF3IP2-4932R | Recombinant Rhesus monkey TRAF3IP2 Protein, His-tagged | +Inquiry |
| TRAF3IP2-2918H | Recombinant Human TRAF3IP2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRAF3IP2-821HCL | Recombinant Human TRAF3IP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAF3IP2 Products
Required fields are marked with *
My Review for All TRAF3IP2 Products
Required fields are marked with *
