Recombinant Human TRAF3IP2 protein, His-tagged

Cat.No. : TRAF3IP2-2918H
Product Overview : Recombinant Human TRAF3IP2 protein(1-350 aa), fused to His tag, was expressed in E. coli.
Availability November 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-350 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TRAF3IP2 TRAF3 interacting protein 2 [ Homo sapiens ]
Official Symbol TRAF3IP2
Synonyms TRAF3IP2; TRAF3 interacting protein 2; C6orf2, C6orf4, C6orf5, C6orf6, chromosome 6 open reading frame 2 , chromosome 6 open reading frame 5; adapter protein CIKS; ACT1; CIKS; DKFZP586G0522; NFkB-activating protein ACT1; connection to IKK and SAPK/JNK; nuclear factor NF-kappa-B activator 1; C6orf2; C6orf4; C6orf5; C6orf6; PSORS13; MGC3581; DKFZp586G0522;
Gene ID 10758
mRNA Refseq NM_001164281
Protein Refseq NP_001157753
MIM 607043
UniProt ID O43734

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAF3IP2 Products

Required fields are marked with *

My Review for All TRAF3IP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon