Recombinant Human TRAF7 protein, GST-tagged

Cat.No. : TRAF7-7863H
Product Overview : Recombinant Human TRAF7 protein(1-150 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1-150 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : LSARKDHEGSCDYRPVRCPNNPSCPPLLRMNLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDEL
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name TRAF7 TNF receptor-associated factor 7, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol TRAF7
Synonyms TRAF7; TNF receptor-associated factor 7, E3 ubiquitin protein ligase; RFWD1, ring finger and WD repeat domain 1 , TNF receptor associated factor 7; E3 ubiquitin-protein ligase TRAF7; DKFZp586I021; MGC7807; RNF119; RING finger protein 119; ring finger and WD repeat domain 1; RING finger and WD repeat-containing protein 1; RFWD1;
mRNA Refseq NM_032271
Protein Refseq NP_115647
MIM 606692
UniProt ID Q6Q0C0
Gene ID 84231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAF7 Products

Required fields are marked with *

My Review for All TRAF7 Products

Required fields are marked with *

0
cart-icon