Recombinant Human TRAF7 protein, GST-tagged
Cat.No. : | TRAF7-7863H |
Product Overview : | Recombinant Human TRAF7 protein(1-150 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-150 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | LSARKDHEGSCDYRPVRCPNNPSCPPLLRMNLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDEL |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TRAF7 TNF receptor-associated factor 7, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | TRAF7 |
Synonyms | TRAF7; TNF receptor-associated factor 7, E3 ubiquitin protein ligase; RFWD1, ring finger and WD repeat domain 1 , TNF receptor associated factor 7; E3 ubiquitin-protein ligase TRAF7; DKFZp586I021; MGC7807; RNF119; RING finger protein 119; ring finger and WD repeat domain 1; RING finger and WD repeat-containing protein 1; RFWD1; |
mRNA Refseq | NM_032271 |
Protein Refseq | NP_115647 |
MIM | 606692 |
UniProt ID | Q6Q0C0 |
Gene ID | 84231 |
◆ Recombinant Proteins | ||
TRAF7-7863H | Recombinant Human TRAF7 protein, GST-tagged | +Inquiry |
TRAF7-5042Z | Recombinant Zebrafish TRAF7 | +Inquiry |
TRAF7-1903C | Recombinant Chicken TRAF7 | +Inquiry |
TRAF7-4749R | Recombinant Rhesus Macaque TRAF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAF7-4935R | Recombinant Rhesus monkey TRAF7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAF7-816HCL | Recombinant Human TRAF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAF7 Products
Required fields are marked with *
My Review for All TRAF7 Products
Required fields are marked with *
0
Inquiry Basket