Recombinant Human TRAK1 protein, GST-tagged

Cat.No. : TRAK1-301591H
Product Overview : Recombinant Human TRAK1 (1-133 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Cys133
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MSLRDKGGEEECFEYDCQDEERKPTHRQHDTQDLLEEVLCAERVGQMTKTYNDIDAVTRLLEEKERDLELAARIGQSLLKKNKTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTSAAEESEPESVC
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TRAK1 trafficking protein, kinesin binding 1 [ Homo sapiens ]
Official Symbol TRAK1
Synonyms TRAK1; trafficking protein, kinesin binding 1; trafficking kinesin-binding protein 1; KIAA1042; MILT1; milton homolog 1 (Drosophila); O linked N acetylglucosamine transferase interacting protein 106; OGT(O Glc NAc transferase) interacting protein 106 KDa; OIP106; milton homolog 1; 106 kDa O-GlcNAc transferase-interacting protein; OGT(O-Glc-NAc transferase)-interacting protein 106 KDa; O-linked N-acetylglucosamine transferase interacting protein 106;
Gene ID 22906
mRNA Refseq NM_001042646
Protein Refseq NP_001036111
MIM 608112
UniProt ID Q9UPV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAK1 Products

Required fields are marked with *

My Review for All TRAK1 Products

Required fields are marked with *

0
cart-icon