Recombinant Human TRAK1 protein, GST-tagged

• Cat.No.: TRAK1-301591H
• Product Overview: Recombinant Human TRAK1 (1-133 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Cys133
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSLRDKGGEEECFEYDCQDEERKPTHRQHDTQDLLEEVLCAERVGQMTKTYNDIDAVTRLLEEKERDLELAARIGQSLLKKNKTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTSAAEESEPESVC
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TRAK1 trafficking protein, kinesin binding 1 [ Homo sapiens ]
• Official Symbol: TRAK1
• Synonyms: TRAK1; trafficking protein, kinesin binding 1; trafficking kinesin-binding protein 1; KIAA1042; MILT1; milton homolog 1 (Drosophila); O linked N acetylglucosamine transferase interacting protein 106; OGT(O Glc NAc transferase) interacting protein 106 KDa; OIP106; milton homolog 1; 106 kDa O-GlcNAc transferase-interacting protein; OGT(O-Glc-NAc transferase)-interacting protein 106 KDa; O-linked N-acetylglucosamine transferase interacting protein 106
• Gene ID: 22906
• mRNA Refseq: NM_001042646
• Protein Refseq: NP_001036111
• MIM: 608112
• UniProt ID: Q9UPV9