Recombinant Human transforming growth factor beta receptor 1 Protein, His tagged

Cat.No. : TGFBR1-001H
Product Overview : Recombinant Human TGFBR1 Protein (34-125aa) with C-His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 34-125aa
Description : The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene.
Tag : C-His
Molecular Mass : 11 kDa
AA Sequence : LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : PBS, pH 7.4
Concentration : 1.0 mg/mL by BCA
Gene Name TGFBR1 transforming growth factor beta receptor 1 [ Homo sapiens (human) ]
Official Symbol TGFBR1
Synonyms TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1
Gene ID 7046
mRNA Refseq NM_001130916
Protein Refseq NP_001124388
MIM 190181
UniProt ID P36897

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFBR1 Products

Required fields are marked with *

My Review for All TGFBR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon