Recombinant Human transforming growth factor beta receptor 1 Protein, His tagged
Cat.No. : | TGFBR1-001H |
Product Overview : | Recombinant Human TGFBR1 Protein (34-125aa) with C-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 34-125aa |
Description : | The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. |
Tag : | C-His |
Molecular Mass : | 11 kDa |
AA Sequence : | LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | PBS, pH 7.4 |
Concentration : | 1.0 mg/mL by BCA |
Gene Name | TGFBR1 transforming growth factor beta receptor 1 [ Homo sapiens (human) ] |
Official Symbol | TGFBR1 |
Synonyms | TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1 |
Gene ID | 7046 |
mRNA Refseq | NM_001130916 |
Protein Refseq | NP_001124388 |
MIM | 190181 |
UniProt ID | P36897 |
◆ Recombinant Proteins | ||
Tgfbr1-439M | Active Recombinant Mouse Tgfbr1, Fc Chimera | +Inquiry |
TGFBR1-5523H | TGFBR1 Peptide | +Inquiry |
TGFBR1-1495H | Active Recombinant Human TGFBR1, GST-tagged | +Inquiry |
TGFBR1-1293H | Recombinant Human TGFBR1 Protein (T200-M503), Tag Free | +Inquiry |
RFL6500BF | Recombinant Full Length Bovine Tgf-Beta Receptor Type-1(Tgfbr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR1-001HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
TGFBR1-2482HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFBR1 Products
Required fields are marked with *
My Review for All TGFBR1 Products
Required fields are marked with *