Recombinant Human TRAPPC3 protein, GST-tagged
Cat.No. : | TRAPPC3-301638H |
Product Overview : | Recombinant Human TRAPPC3 (1-180 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Glu180 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TRAPPC3 trafficking protein particle complex 3 [ Homo sapiens ] |
Official Symbol | TRAPPC3 |
Synonyms | TRAPPC3; trafficking protein particle complex 3; trafficking protein particle complex subunit 3; BET3; BET3 homolog; 1110058K12Rik; |
Gene ID | 27095 |
mRNA Refseq | NM_014408 |
Protein Refseq | NP_055223 |
MIM | 610955 |
UniProt ID | O43617 |
◆ Recombinant Proteins | ||
TRAPPC3-104H | Recombinant Human TRAPPC3 protein, His-tagged | +Inquiry |
TRAPPC3-301638H | Recombinant Human TRAPPC3 protein, GST-tagged | +Inquiry |
TRAPPC3-6263R | Recombinant Rat TRAPPC3 Protein | +Inquiry |
TRAPPC3-9570M | Recombinant Mouse TRAPPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAPPC3-5920R | Recombinant Rat TRAPPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAPPC3-807HCL | Recombinant Human TRAPPC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRAPPC3 Products
Required fields are marked with *
My Review for All TRAPPC3 Products
Required fields are marked with *
0
Inquiry Basket