Recombinant Human TRAPPC3 protein, GST-tagged
| Cat.No. : | TRAPPC3-301638H |
| Product Overview : | Recombinant Human TRAPPC3 (1-180 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Glu180 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | TRAPPC3 trafficking protein particle complex 3 [ Homo sapiens ] |
| Official Symbol | TRAPPC3 |
| Synonyms | TRAPPC3; trafficking protein particle complex 3; trafficking protein particle complex subunit 3; BET3; BET3 homolog; 1110058K12Rik; |
| Gene ID | 27095 |
| mRNA Refseq | NM_014408 |
| Protein Refseq | NP_055223 |
| MIM | 610955 |
| UniProt ID | O43617 |
| ◆ Recombinant Proteins | ||
| TRAPPC3-9570M | Recombinant Mouse TRAPPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRAPPC3-5166H | Recombinant Human TRAPPC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TRAPPC3-1028Z | Recombinant Zebrafish TRAPPC3 | +Inquiry |
| TRAPPC3-6263R | Recombinant Rat TRAPPC3 Protein | +Inquiry |
| TRAPPC3-4945R | Recombinant Rhesus monkey TRAPPC3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRAPPC3-807HCL | Recombinant Human TRAPPC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAPPC3 Products
Required fields are marked with *
My Review for All TRAPPC3 Products
Required fields are marked with *
