Recombinant Human TRAPPC3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TRAPPC3-5166H
Product Overview : TRAPPC3 MS Standard C13 and N15-labeled recombinant protein (NP_055223) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. The encoded protein participates in the regulation of transport from the endoplasmic reticulum to the Golgi apparatus. Alternative splicing results in multiple transcript variants.
Molecular Mass : 20.3 kDa
AA Sequence : MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TRAPPC3 trafficking protein particle complex 3 [ Homo sapiens (human) ]
Official Symbol TRAPPC3
Synonyms TRAPPC3; trafficking protein particle complex 3; trafficking protein particle complex subunit 3; BET3; BET3 homolog; 1110058K12Rik;
Gene ID 27095
mRNA Refseq NM_014408
Protein Refseq NP_055223
MIM 610955
UniProt ID O43617

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAPPC3 Products

Required fields are marked with *

My Review for All TRAPPC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon