Recombinant Human TRAPPC3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TRAPPC3-5166H |
Product Overview : | TRAPPC3 MS Standard C13 and N15-labeled recombinant protein (NP_055223) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. The encoded protein participates in the regulation of transport from the endoplasmic reticulum to the Golgi apparatus. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 20.3 kDa |
AA Sequence : | MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TRAPPC3 trafficking protein particle complex 3 [ Homo sapiens (human) ] |
Official Symbol | TRAPPC3 |
Synonyms | TRAPPC3; trafficking protein particle complex 3; trafficking protein particle complex subunit 3; BET3; BET3 homolog; 1110058K12Rik; |
Gene ID | 27095 |
mRNA Refseq | NM_014408 |
Protein Refseq | NP_055223 |
MIM | 610955 |
UniProt ID | O43617 |
◆ Recombinant Proteins | ||
TRAPPC3-5166H | Recombinant Human TRAPPC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TRAPPC3-104H | Recombinant Human TRAPPC3 protein, His-tagged | +Inquiry |
TRAPPC3-4759R | Recombinant Rhesus Macaque TRAPPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAPPC3-1028Z | Recombinant Zebrafish TRAPPC3 | +Inquiry |
TRAPPC3-6263R | Recombinant Rat TRAPPC3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAPPC3-807HCL | Recombinant Human TRAPPC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAPPC3 Products
Required fields are marked with *
My Review for All TRAPPC3 Products
Required fields are marked with *
0
Inquiry Basket